Clone MIP14966 Report

Search the DGRC for MIP14966

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:149
Well:66
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14762-RB
Protein status:MIP14966.pep: gold
Sequenced Size:3100

Clone Sequence Records

MIP14966.complete Sequence

3100 bp assembled on 2009-11-24

GenBank Submission: BT100303.1

> MIP14966.complete
CCAGCATCGGAATCCGCGACCAGTCACGACAGTGACGCTTTCTGCCGCGG
AATAAGAAATCCTTCACCCAATCTCACAGTCGCCCCAACGAAATCGTAAG
CCACCAGCAGGTGTTCAGCATGGCGGGAATTCAGCTGCAATCGGGATGCA
CGATGGTCGTGACGGTGGTGCTCCTGCTGCAGGTGCTTGTGATGGACCAG
GTGCTCGGCCAGGGTCCACCGCAGACTCAAGTGTGTCCGGAGCAGAGCGA
GATCGCGCCCTGCATCTGCACGGTGAAGAAGAACGGGCTGGACATCCTGT
GCGAGACCACCGATCTGGCGCACATCACCAAGTCGATGGGCACGCTGAAG
GGCAAGAGTCCCATCATCTTCTACCTGAAGCTTCGCCACAACAATCTGCC
CAAGCTGCAGGGCTTCGTCTTCCTGGCCCTTGACATCCGTCACCTGACCA
TCCACAACAGCAGCCTGGCGGCCATCGAGGAGAACGCCCTCAGCTCGCTG
GGAGCGGGACTGACGCAGCTGGATGTGTCCCTCAACCAAATGAAGACGGT
GCCCTCGCAGGCTCTGCAACATCTGTTCCACCTGTTGATCCTTAATCTGA
ACCACAATAAAATCACCGTGATCCACAACAATGCCTTCGAGGGACTGGAG
ACCCTGGAGATTCTGACGCTCTACGAGAACAAGATTACACAGATCGATCC
CGAGGCTTTCCGAGGACTTGAGGACCATATTAAGCGCCTGAATTTGGGTG
GCAACGATCTTACCAATATCCCGCAGAAAGCTCTTTCCATTTTGAGCACC
TTAAAGAAACTGGAGATTCAGGAGAACAAGATACGAACTATCAGCGAAGG
CGATTTCGAAGGCTTGCAGAGCCTGGACTCATTGATTTTGGCCCACAACA
TGATCACCACCGTGCCTGCCAATGTGTTTAGTCACCTCACCCTGCTAAAC
TCCTTGGAGCTGGAGGGCAATAAGATCAGTGTGATTGACAAGGATGCCTT
CAAGGGCCTAGAGGAGAACCTGCAATATCTGCGCCTGGGTGATAACCAGA
TCCACACTATTCCCAGCGAGGCACTGCGTCCGCTGCACCGCCTTCGCCAC
TTGGACTTGCGCAACAACAATATCAATGTTTTGGCTGAAGATGCCTTCAC
TGGCTTTGGAGATTCCCTGACTTTCCTCAACCTGCAGAAGAACGACATCA
AGGTTCTGCCCAGTCTTCTGTTTGAGAACCTCAACTCGCTGGAAACGCTG
AACCTGCAGAACAACAAGTTGCAGCGCATTCCGCAGGACATAATGGAGCC
CGTCATCGACACCCTTCGCATCATCGATATCACCGATAACCCGCTGAACT
GCTCCTGCGAGCTGACCTGGTTCCCCAAGCTGCTGGAGGACCTGAAGAAC
AAGGACGACGAAATGTCGCAGAAGAAGAAGCCGCTGTGCCACATGTCGCT
GGACAACCGCGAGTACTTCGTGCAGGCCATGCCCACCGAGAAGATGCACT
GCGCCGGCCTCAATGTGAGTCCCTCGCCGACCAGCGGCGGTCTAATGCGG
ATCCTGCAAGTGAACATCCTGGCCCAGATTGCCGTGTGTAGCGTGGCCTT
TTTAACTAGCGTCTAAGCATCTAGCCGCTGTCCAGCTAGACGCGATGTTC
TATGTGGATTATAGGGAATCCGTGAATTATGCAACTCTGCCAGTAATTAG
ACTCAGAAAGCACGCTTTTCGAACCAGCAGCAGGCCTCCCCCCAGCAAAG
TTGCTGAGATGACGCCCCTGGAGAGGCACCACCACCACTATCCGGTCCAC
CCCCCACTGCACTCCGCTCCGGACGTGCACAGTAGCTCGACGAGAAGGGG
AATGCTGGGATGATATTTACTTGTCCGCGGACATAGCTTAGTTATAAGGC
TTGATTTAGGCACCAGTGCACCTGCGGAGGCCAAAACCAAAACCAAAACA
GAAAGCTAAACAGAAACCTAAACCCAAACCAAAATCGAAACCCAAACATA
TCAGAATATTGTTACGTTTAAGCGAGAGATTTTGTTGTTACTCGCGTTAA
TCTGTACGAGTTTATCTGTGCAGCCTAGGGCTCCGTTTGCCCATCTATTA
TGTGTAGTCTATCGTCGTCTTGTCGTCGGTGTTGTGAGATACAATCATTA
CTAACGCGTTTCGTAGTCCCTCCGCCCGTTTCCAGACCTACCTTCAGCAC
CCAACCGATACCCAGTCGAAATTCGCAAGCTCCTCGAGTCCATGTGTCGT
GTTAACCAATTCTCAGCAACCATGGCCAAATGTGGCTCCACTTTGGGTGC
CAGAGGCGGGCGAAACAAAGCGAAGGCACAAGAGAAAGTAAGAAAATTTC
ATTTGCATCAATCACCAAGAACTGATTATGGAATAAGTAGTTTGTACTCT
TTATTTGCCACAAACACGGGCAAACTCCCAAGAAATCCCAATTCCATAAC
CCATAACCCTTAATCCAAAAAGGGGCAACCCACGAAGGTCGAGAATGCAT
ATCGTTATATTGTTATATTATATCGTGACATATCAAGAGCTCCCAGTAGT
AAGACACTCGGATGGCTCGACACAGCTAATATAGTGACATTTTATAGAAT
TTACTTACATTTTTGAGGCATCTGACAAGTTTGATATATTTATGCAGAAG
TGAATTAAGCAAATGCAGCGTGTATGCAGAGTGGAATTTTTGAAATTTTT
TATACATATACTTTTATACACACATACATACGTACCTTTTCGATTATGTC
TACGCAAACTAAGTTGTAATCCGATTAGCTATACTGACACTGACACTCCA
AGTCCGCCCGATCCCCTACCCGCCTCCACGCCAACCACGCGGTGGCTTAG
GTCAGTAGCCACCCACTGGTGGGCGGTGGTGCAGCGGGAGCGGGCTCGGG
TCCGGAAATATTTTCAAGAGAATGCGCCGCACCACCGATTCGGGTCAGTT
TCCTTTGGCTAGAGCTGTTCTTTTCAAAATATTGCAAAACACTGAACCCC
ATCGAAAGCTGGGCTTACATAATGCTCTCCATGTGAGCAATCTGAAAATC
TATCTAATAAAGAATCCATGTTGGTTACAAAAAAAAAAAAAAAAAAAAAA

MIP14966.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-RA 3715 CG14762-RA 767..2280 1..1514 7570 100 Plus
CG14762-RA 3715 CG14762-RA 2281..3704 1658..3081 7105 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3896544..3897966 3078..1657 6990 99.6 Minus
chr2R 21145070 chr2R 3899766..3900267 502..1 2495 99.8 Minus
chr2R 21145070 chr2R 3898191..3898513 1657..1335 1615 100 Minus
chr2R 21145070 chr2R 3899480..3899703 724..501 1120 100 Minus
chr2R 21145070 chr2R 3898821..3899002 1195..1014 910 100 Minus
chr2R 21145070 chr2R 3899063..3899217 1014..860 775 100 Minus
chr2R 21145070 chr2R 3899285..3899422 862..725 690 100 Minus
chr2R 21145070 chr2R 3898592..3898731 1335..1196 685 99.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-RB 1497 CG14762-PB 1..1497 120..1616 7485 100 Plus
CG14762-RA 1413 CG14762-PA 1..1395 120..1514 6975 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:18:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-RB 3801 CG14762-RB 718..3795 1..3078 15375 100 Plus
CG14762-RA 3658 CG14762-RA 718..2231 1..1514 7570 100 Plus
CG14762-RA 3658 CG14762-RA 2232..3652 1658..3078 7090 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-PB 498 CG14762-PB 1..498 120..1613 2223 100 Plus
CG14762-PA 470 CG14762-PA 1..470 120..1529 2073 99.1 Plus
caps-PB 540 CG11282-PB 74..410 435..1385 315 32.1 Plus
caps-PA 540 CG11282-PA 74..410 435..1385 315 32.1 Plus
caps-PD 780 CG11282-PD 74..410 435..1385 315 32.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8009122..8010546 3081..1657 7110 99.9 Minus
2R 25286936 2R 8012346..8012847 502..1 2510 100 Minus
2R 25286936 2R 8010771..8011093 1657..1335 1615 100 Minus
2R 25286936 2R 8012060..8012283 724..501 1120 100 Minus
2R 25286936 2R 8011401..8011582 1195..1014 910 100 Minus
2R 25286936 2R 8011643..8011797 1014..860 775 100 Minus
2R 25286936 2R 8011172..8011311 1335..1196 700 100 Minus
2R 25286936 2R 8011865..8012002 862..725 690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8010321..8011745 3081..1657 7110 99.9 Minus
2R 25260384 2R 8013545..8014046 502..1 2510 100 Minus
2R 25260384 2R 8011970..8012292 1657..1335 1615 100 Minus
2R 25260384 2R 8013259..8013482 724..501 1120 100 Minus
2R 25260384 2R 8012600..8012781 1195..1014 910 100 Minus
2R 25260384 2R 8012842..8012996 1014..860 775 100 Minus
2R 25260384 2R 8012371..8012510 1335..1196 700 100 Minus
2R 25260384 2R 8013064..8013201 862..725 690 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:04:43 has no hits.

MIP14966.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:20:57 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3899767..3900267 1..501 99   Minus
chr2R 3899480..3899702 502..724 100 <- Minus
chr2R 3899286..3899422 725..861 100 <- Minus
chr2R 3899063..3899215 862..1014 100 <- Minus
chr2R 3898821..3899001 1015..1195 100 <- Minus
chr2R 3898592..3898731 1196..1335 99 <- Minus
chr2R 3898191..3898512 1336..1657 100 <- Minus
chr2R 3897693..3897965 1658..1930 100 <- Minus
chr2R 3896544..3897624 1999..3078 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-24 11:31:44 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RA 1..1395 120..1514 100 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:25:17 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 1..1497 120..1616 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:56:24 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 1..1497 120..1616 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:57 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 1..1497 120..1616 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-24 11:31:44 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RA 717..2230 1..1514 100 == Plus
CG14762-RA 2231..3651 1658..3078 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:25:16 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 717..3794 1..3078 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:56:24 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 718..3795 1..3078 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:57 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
CG14762-RB 718..3795 1..3078 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:20:57 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8012347..8012847 1..501 100   Minus
2R 8012060..8012282 502..724 100 <- Minus
2R 8011866..8012002 725..861 100 <- Minus
2R 8011643..8011795 862..1014 100 <- Minus
2R 8011401..8011581 1015..1195 100 <- Minus
2R 8011172..8011311 1196..1335 100 <- Minus
2R 8010771..8011092 1336..1657 100 <- Minus
2R 8009125..8010545 1658..3078 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:56:24 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3899852..3900352 1..501 100   Minus
arm_2R 3899565..3899787 502..724 100 <- Minus
arm_2R 3899371..3899507 725..861 100 <- Minus
arm_2R 3899148..3899300 862..1014 100 <- Minus
arm_2R 3898906..3899086 1015..1195 100 <- Minus
arm_2R 3898677..3898816 1196..1335 100 <- Minus
arm_2R 3898276..3898597 1336..1657 100 <- Minus
arm_2R 3896630..3898050 1658..3078 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:10 Download gff for MIP14966.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8013546..8014046 1..501 100   Minus
2R 8013259..8013481 502..724 100 <- Minus
2R 8013065..8013201 725..861 100 <- Minus
2R 8012842..8012994 862..1014 100 <- Minus
2R 8012600..8012780 1015..1195 100 <- Minus
2R 8012371..8012510 1196..1335 100 <- Minus
2R 8011970..8012291 1336..1657 100 <- Minus
2R 8010324..8011744 1658..3078 99 <- Minus

MIP14966.pep Sequence

Translation from 119 to 1615

> MIP14966.pep
MAGIQLQSGCTMVVTVVLLLQVLVMDQVLGQGPPQTQVCPEQSEIAPCIC
TVKKNGLDILCETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFV
FLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQ
HLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGL
EDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQ
SLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEEN
LQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSL
TFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLR
IIDITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYF
VQAMPTEKMHCAGLNVSPSPTSGGLMRILQVNILAQIAVCSVAFLTSV*

MIP14966.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11219-PA 499 GF11219-PA 25..499 27..498 2356 94.9 Plus
Dana\GF24034-PA 748 GF24034-PA 63..399 106..422 351 30.9 Plus
Dana\GF24031-PA 740 GF24031-PA 61..397 106..422 335 31.8 Plus
Dana\GF16594-PA 1276 GF16594-PA 19..390 41..405 297 27.1 Plus
Dana\GF15603-PA 562 GF15603-PA 24..324 66..393 280 28.6 Plus
Dana\GF16594-PA 1276 GF16594-PA 460..798 106..409 253 28.2 Plus
Dana\GF16594-PA 1276 GF16594-PA 334..595 155..410 195 27.7 Plus
Dana\GF16594-PA 1276 GF16594-PA 79..219 269..409 193 40.4 Plus
Dana\GF16594-PA 1276 GF16594-PA 587..966 86..409 179 23.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10684-PA 470 GG10684-PA 1..470 1..470 2337 97 Plus
Dere\GG15631-PA 757 GG15631-PA 64..400 106..422 381 33.8 Plus
Dere\GG15627-PA 738 GG15627-PA 61..409 106..434 353 31.5 Plus
Dere\GG11882-PA 1315 GG11882-PA 37..408 41..405 295 27.1 Plus
Dere\GG13307-PA 1535 GG13307-PA 602..936 86..424 275 26.2 Plus
Dere\GG11882-PA 1315 GG11882-PA 478..816 106..409 254 28.2 Plus
Dere\GG11882-PA 1315 GG11882-PA 352..613 155..410 193 27.7 Plus
Dere\GG11882-PA 1315 GG11882-PA 97..238 269..410 192 40.1 Plus
Dere\GG11882-PA 1315 GG11882-PA 686..984 106..409 178 26.2 Plus
Dere\GG15631-PA 757 GG15631-PA 208..404 131..333 169 30.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19994-PA 505 GH19994-PA 35..504 27..497 2323 92.8 Plus
Dgri\GH17152-PA 411 GH17152-PA 57..393 106..422 369 33.2 Plus
Dgri\GH17150-PA 762 GH17150-PA 65..419 106..440 307 29.8 Plus
Dgri\GH14339-PA 1315 GH14339-PA 37..388 41..362 294 27.5 Plus
Dgri\GH15790-PA 619 GH15790-PA 189..537 86..441 293 28.3 Plus
Dgri\GH17150-PA 762 GH17150-PA 60..267 199..409 153 27.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-PB 498 CG14762-PB 1..498 1..498 2537 100 Plus
CG14762-PA 470 CG14762-PA 1..470 1..470 2387 99.1 Plus
caps-PB 540 CG11282-PB 74..410 106..422 388 32.1 Plus
caps-PA 540 CG11282-PA 74..410 106..422 388 32.1 Plus
caps-PD 780 CG11282-PD 74..410 106..422 388 32.1 Plus
caps-PB 540 CG11282-PB 172..414 86..333 179 27.9 Plus
caps-PA 540 CG11282-PA 172..414 86..333 179 27.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19172-PA 498 GI19172-PA 1..498 1..498 2275 88.6 Plus
Dmoj\GI11762-PA 531 GI11762-PA 58..395 105..422 374 33.5 Plus
Dmoj\GI11760-PA 754 GI11760-PA 60..409 106..434 324 30.6 Plus
Dmoj\GI10434-PA 1339 GI10434-PA 61..414 41..389 306 27.5 Plus
Dmoj\GI12570-PA 617 GI12570-PA 189..535 119..441 287 28.8 Plus
Dmoj\GI10434-PA 1339 GI10434-PA 502..840 106..409 251 27.3 Plus
Dmoj\GI10434-PA 1339 GI10434-PA 336..684 91..409 190 26.4 Plus
Dmoj\GI10434-PA 1339 GI10434-PA 121..262 269..410 185 38.7 Plus
Dmoj\GI10434-PA 1339 GI10434-PA 629..1008 86..409 179 23.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10601-PA 1007 GL10601-PA 536..1007 27..498 2311 93.2 Plus
Dper\GL15703-PA 784 GL15703-PA 71..388 106..422 334 31.8 Plus
Dper\GL17930-PA 640 GL17930-PA 169..558 41..441 322 27.4 Plus
Dper\GL13952-PA 1315 GL13952-PA 37..408 41..405 295 26.6 Plus
Dper\GL24567-PA 381 GL24567-PA 57..332 106..384 289 32.8 Plus
Dper\GL24567-PA 381 GL24567-PA 126..365 129..343 225 30.7 Plus
Dper\GL24567-PA 381 GL24567-PA 52..259 199..409 152 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13229-PA 499 GA13229-PA 23..499 22..498 2308 92.2 Plus
Dpse\GA23763-PA 539 GA23763-PA 71..407 106..422 379 33.1 Plus
Dpse\GA10887-PA 757 GA10887-PA 57..405 106..434 329 30.1 Plus
Dpse\GA20402-PA 616 GA20402-PA 145..534 41..441 323 27.4 Plus
Dpse\GA14511-PA 1315 GA14511-PA 37..408 41..405 296 26.6 Plus
Dpse\GA10887-PA 757 GA10887-PA 52..259 199..409 157 27 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20730-PA 480 GM20730-PA 1..480 1..498 2302 93.8 Plus
Dsec\GM25406-PA 752 GM25406-PA 62..398 106..422 369 32.4 Plus
Dsec\GM25399-PA 737 GM25399-PA 61..409 106..434 344 31.3 Plus
Dsec\GM12100-PA 1315 GM12100-PA 37..408 41..405 296 27.1 Plus
Dsec\GM21667-PA 1197 GM21667-PA 227..587 86..424 279 28.2 Plus
Dsec\GM12100-PA 1315 GM12100-PA 478..816 106..409 246 28.2 Plus
Dsec\GM12100-PA 1315 GM12100-PA 97..238 269..410 193 40.1 Plus
Dsec\GM12100-PA 1315 GM12100-PA 352..613 155..410 191 27.7 Plus
Dsec\GM12100-PA 1315 GM12100-PA 686..984 106..409 177 26.2 Plus
Dsec\GM25406-PA 752 GM25406-PA 206..402 131..333 164 30.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14437-PA 433 GD14437-PA 62..403 106..427 380 32.2 Plus
Dsim\GD14431-PA 737 GD14431-PA 61..409 106..434 344 31.3 Plus
Dsim\GD16557-PA 1315 GD16557-PA 37..408 41..405 296 27.1 Plus
Dsim\GD17556-PA 1472 GD17556-PA 28..348 86..395 278 29.4 Plus
Dsim\GD11532-PA 537 GD11532-PA 165..459 178..424 272 28.6 Plus
Dsim\GD16557-PA 1315 GD16557-PA 478..816 106..409 246 28.2 Plus
Dsim\GD17556-PA 1472 GD17556-PA 209..618 62..427 211 25 Plus
Dsim\GD17556-PA 1472 GD17556-PA 12..314 142..385 194 26.8 Plus
Dsim\GD16557-PA 1315 GD16557-PA 97..238 269..410 193 40.1 Plus
Dsim\GD17556-PA 1472 GD17556-PA 504..895 68..409 192 26.9 Plus
Dsim\GD16557-PA 1315 GD16557-PA 352..613 155..410 191 27.7 Plus
Dsim\GD17556-PA 1472 GD17556-PA 349..683 81..421 184 26.1 Plus
Dsim\GD16557-PA 1315 GD16557-PA 686..984 106..409 176 26.2 Plus
Dsim\GD17556-PA 1472 GD17556-PA 636..980 76..424 172 27 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20234-PA 500 GJ20234-PA 22..500 22..498 2257 92.1 Plus
Dvir\GJ13467-PA 755 GJ13467-PA 60..396 106..422 323 31.5 Plus
Dvir\GJ13470-PA 539 GJ13470-PA 75..312 106..346 322 36.8 Plus
Dvir\GJ10649-PA 1315 GJ10649-PA 37..390 41..389 306 27.8 Plus
Dvir\GJ15474-PA 608 GJ15474-PA 178..526 86..441 290 28.3 Plus
Dvir\GJ10649-PA 1315 GJ10649-PA 478..816 106..409 253 27.6 Plus
Dvir\GJ13470-PA 539 GJ13470-PA 70..304 126..387 229 31.7 Plus
Dvir\GJ10649-PA 1315 GJ10649-PA 312..660 91..409 190 26.4 Plus
Dvir\GJ10649-PA 1315 GJ10649-PA 97..238 269..410 184 38 Plus
Dvir\GJ13470-PA 539 GJ13470-PA 146..344 131..334 183 29.8 Plus
Dvir\GJ10649-PA 1315 GJ10649-PA 605..944 86..389 181 26.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21558-PA 486 GK21558-PA 11..486 22..498 2283 90.8 Plus
Dwil\GK17431-PA 778 GK17431-PA 61..397 106..422 332 32.1 Plus
Dwil\GK17433-PA 762 GK17433-PA 61..397 106..422 332 31.5 Plus
Dwil\GK17595-PA 614 GK17595-PA 143..532 41..441 312 26.6 Plus
Dwil\GK13202-PA 1397 GK13202-PA 177..487 97..409 308 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23377-PA 470 GE23377-PA 1..470 1..470 2350 97.9 Plus
Dyak\GE21954-PA 740 GE21954-PA 61..409 106..434 339 30.7 Plus
Dyak\chp-PA 1315 GE23330-PA 37..408 41..405 296 27.1 Plus
Dyak\GE22397-PA 1534 GE22397-PA 601..935 86..424 273 26.2 Plus
Dyak\GE12132-PA 800 GE12132-PA 169..463 178..424 272 28.6 Plus
Dyak\chp-PA 1315 GE23330-PA 478..816 106..409 245 27.9 Plus
Dyak\chp-PA 1315 GE23330-PA 352..613 155..410 193 27.7 Plus
Dyak\chp-PA 1315 GE23330-PA 97..238 269..410 193 40.1 Plus
Dyak\chp-PA 1315 GE23330-PA 605..984 86..409 178 23.1 Plus

MIP14966.hyp Sequence

Translation from 119 to 1615

> MIP14966.hyp
MAGIQLQSGCTMVVTVVLLLQVLVMDQVLGQGPPQTQVCPEQSEIAPCIC
TVKKNGLDILCETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFV
FLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQ
HLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGL
EDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQ
SLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEEN
LQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSL
TFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLR
IIDITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYF
VQAMPTEKMHCAGLNVSPSPTSGGLMRILQVNILAQIAVCSVAFLTSV*

MIP14966.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14762-PB 498 CG14762-PB 1..498 1..498 2537 100 Plus
CG14762-PA 470 CG14762-PA 1..470 1..470 2387 99.1 Plus
caps-PB 540 CG11282-PB 74..410 106..422 388 32.1 Plus
caps-PA 540 CG11282-PA 74..410 106..422 388 32.1 Plus
caps-PD 780 CG11282-PD 74..410 106..422 388 32.1 Plus
caps-PB 540 CG11282-PB 172..414 86..333 179 27.9 Plus
caps-PA 540 CG11282-PA 172..414 86..333 179 27.9 Plus