Clone MIP15314 Report

Search the DGRC for MIP15314

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:153
Well:14
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptGstE12-RA
Protein status:MIP15314.pep: gold
Sequenced Size:1350

Clone Sequence Records

MIP15314.complete Sequence

1350 bp assembled on 2010-01-05

GenBank Submission: BT120105.1

> MIP15314.complete
CGGAGAAGACGTTCGTGCGGCAGTTCTGTATTTACTTTTGTGGTCACAGA
GAAATGTGAGTTGCGAGTGGAGTGCGCTTGTGTGTGTGCGTCAGCCCCCC
ATAAAAACAAACACACACACAGGCTGCATAGGCATTATAAAAACAATTTG
CCGGCGATTGCAGGCGCACACACTCAAACCTGGGGCGCCTTCTGCATGTG
TATGTGCCGCTAATTACATTTATTTTGTAAACTTAATTTCCAAGCCGCCA
AAAGGGGGTTGAAGTGGGGGCGGGGCGCAAGCGATATATGTAGTTTCAGT
ATCTTTCCTACGCCGTGTGGTCGCCATGTTAACTGCTCTGATAAGTCGCC
AGAGATGGGGGCTAGAGATCCGGGGTTATCTGATATTGCTGTGGGTGCGA
CACGGATTCGTTGCTGATACACGAGGGTACTGAAATGGTAGTGGTGTGAG
TGCGGTTTTCAGTAATCTGGAATGCTATCGCTGCTAGACCAGCCGTCCGC
ATCGCGAGGGTGGGATTCAACCATGTCAAAGCCAGCTCTGTATTATGCCA
CCCTAAGTCCCCCATCGCGCGCCGTCCTCCTCACGGCTAAGGCGATCGGA
CTCGACCTTGAACTACGGCCAATTAACCTGCTGAAGGGAGAGCATCTGAC
TCCGGAATTCCTCAAGCTGAACCCCCAGCACACCATCCCGACCCTGATCG
ACGGCGAGGCCACTATCATTGACTCGCACGCCATCTGCGCCTACCTGGTG
GAGAAGTATGGCCAGAAGGAGCAGCAGCTCTATCCGAAGGAATTGGTGCA
GCGCGCCAACGTGGATGCTCGGCTCCATCTGGACTCCGGCCACCTCTTCG
CGCGCCTGCGCTTCCTTTACGAGCCCATCCTGTATTATGGATCGACGGAC
TGCTCCATCGACAAGATCGCATACATCCAGAAGTGCTGGGAGATCCTAGA
GGGATTCCTCAAGGATCAGCCGTATTTGTGTGGTTCTGATCTAACCATCG
CAGACTTTTGCGCCGTGGCCACCGTAACCTCGGTGAACGACACCGCTCCC
ATCGATGAATTTAAGTTTCCCAAGATGCACGCCTGGCTGAAGCGTCTGGC
AGAGCTACCCTACTACCAGGAGGTAAACGGCGACGGCGCTGACGAGCTTA
AGAGCATCTTCAAGGCCAAGCTGGCAGAAAACCGTGGCAAGTAGGCGGCG
GCTCTATTATGTTTTGTTTTATATCCACACATTCTATATGCATATCCACT
TTTGAATAAACGGATTAGATCAAAGTAAGATTTTAGCAGTTAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP15314.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG16936.a 1139 CG16936.a 288..1065 515..1292 3890 100 Plus
CG16936-RA 1025 CG16936-RA 174..951 515..1292 3890 100 Plus
CG16936.a 1139 CG16936.a 89..287 1..199 980 99.4 Plus
CG16936-RA 1025 CG16936-RA 119..173 1..55 275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20652682..20653356 1291..617 3375 100 Minus
chr2R 21145070 chr2R 20653577..20654090 514..1 2540 99.6 Minus
chr2R 21145070 chr2R 20653412..20653516 618..514 525 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-RC 672 CG16936-PC 1..672 523..1194 3360 100 Plus
GstE12-RB 672 CG16936-PB 1..672 523..1194 3360 100 Plus
GstE12-RD 672 CG16936-PD 1..672 523..1194 3360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:18:29 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-RC 1311 CG16936-RC 21..1311 1..1291 6440 99.9 Plus
GstE12-RD 907 CG16936-RD 130..907 514..1291 3890 100 Plus
GstE12-RB 1022 CG16936-RB 220..996 515..1291 3885 100 Plus
GstE12-RD 907 CG16936-RD 1..69 446..514 345 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-PC 223 CG16936-PC 1..223 523..1191 1169 100 Plus
GstE12-PB 223 CG16936-PB 1..223 523..1191 1169 100 Plus
GstE12-PD 223 CG16936-PD 1..223 523..1191 1169 100 Plus
GstE12-PA 223 CG16936-PA 1..223 523..1191 1169 100 Plus
GstE11-PB 225 CG5224-PB 3..225 526..1191 566 49.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24766743..24767418 1292..617 3380 100 Minus
2R 25286936 2R 24767639..24768152 514..1 2555 99.8 Minus
2R 25286936 2R 24767474..24767578 618..514 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24767942..24768617 1292..617 3380 100 Minus
2R 25260384 2R 24768838..24769351 514..1 2555 99.8 Minus
2R 25260384 2R 24768673..24768777 618..514 525 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:19:16 has no hits.

MIP15314.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:15:06 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20653577..20654090 1..514 99   Minus
chr2R 20653413..20653515 515..617 100 <- Minus
chr2R 20652682..20653355 618..1291 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-05 17:32:56 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 1..672 523..1194 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:36 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 1..672 523..1194 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:34 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RD 1..672 523..1194 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:15:06 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RD 1..672 523..1194 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-05 17:32:54 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 56..832 515..1291 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:36 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
CG16936-RA 78..854 515..1291 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:34 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RC 23..1313 1..1291 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:15:06 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
GstE12-RC 21..1311 1..1291 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:15:06 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24767639..24768152 1..514 99   Minus
2R 24767475..24767577 515..617 100 <- Minus
2R 24766744..24767417 618..1291 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:34 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20655162..20655675 1..514 99   Minus
arm_2R 20654998..20655100 515..617 100 <- Minus
arm_2R 20654267..20654940 618..1291 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:58:54 Download gff for MIP15314.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24768856..24769369 1..514 99   Minus
2R 24768692..24768794 515..617 100 <- Minus
2R 24767961..24768634 618..1291 100 <- Minus

MIP15314.hyp Sequence

Translation from 471 to 1193

> MIP15314.hyp
MLSLLDQPSASRGWDSTMSKPALYYATLSPPSRAVLLTAKAIGLDLELRP
INLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKE
QQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIA
YIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFP
KMHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENRGK*

MIP15314.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-PC 223 CG16936-PC 1..223 18..240 1169 100 Plus
GstE12-PB 223 CG16936-PB 1..223 18..240 1169 100 Plus
GstE12-PD 223 CG16936-PD 1..223 18..240 1169 100 Plus
GstE12-PA 223 CG16936-PA 1..223 18..240 1169 100 Plus
GstE11-PB 225 CG5224-PB 3..225 19..240 566 49.3 Plus

MIP15314.pep Sequence

Translation from 471 to 1193

> MIP15314.pep
MLSLLDQPSASRGWDSTMSKPALYYATLSPPSRAVLLTAKAIGLDLELRP
INLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHAICAYLVEKYGQKE
QQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSIDKIA
YIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFP
KMHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENRGK*

MIP15314.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13293-PA 223 GF13293-PA 1..223 18..240 1137 95.1 Plus
Dana\GF11968-PA 972 GF11968-PA 3..216 19..231 567 50.5 Plus
Dana\GF12169-PA 221 GF12169-PA 1..215 18..233 488 47.5 Plus
Dana\GF12173-PA 221 GF12173-PA 1..213 18..231 481 46 Plus
Dana\GF12168-PA 219 GF12168-PA 1..216 18..234 473 46.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19896-PA 223 GG19896-PA 1..223 18..240 1168 98.2 Plus
Dere\GG21901-PA 225 GG21901-PA 3..225 19..240 544 48.4 Plus
Dere\GG21886-PA 222 GG21886-PA 1..216 18..233 511 46.1 Plus
Dere\GG21885-PA 219 GG21885-PA 1..216 18..234 503 47.9 Plus
Dere\GG21891-PA 221 GG21891-PA 1..219 18..236 471 46.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21542-PA 224 GH21542-PA 1..222 18..239 1015 83.3 Plus
Dgri\GH19714-PA 221 GH19714-PA 3..221 19..237 597 51.6 Plus
Dgri\GH15974-PA 219 GH15974-PA 1..213 18..231 511 49.5 Plus
Dgri\GH21668-PA 217 GH21668-PA 1..216 18..234 494 48.2 Plus
Dgri\GH21671-PA 221 GH21671-PA 1..219 18..236 467 44.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
GstE12-PC 223 CG16936-PC 1..223 18..240 1169 100 Plus
GstE12-PB 223 CG16936-PB 1..223 18..240 1169 100 Plus
GstE12-PD 223 CG16936-PD 1..223 18..240 1169 100 Plus
GstE12-PA 223 CG16936-PA 1..223 18..240 1169 100 Plus
GstE11-PB 225 CG5224-PB 3..225 19..240 566 49.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19515-PA 223 GI19515-PA 1..223 18..240 1031 83.4 Plus
Dmoj\GI20133-PA 225 GI20133-PA 6..225 18..237 613 52.3 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..213 18..231 507 50 Plus
Dmoj\GI20121-PA 222 GI20121-PA 1..216 18..233 499 47.9 Plus
Dmoj\GI16623-PA 219 GI16623-PA 1..214 18..232 495 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17702-PA 223 GL17702-PA 1..223 18..240 1107 91.5 Plus
Dper\GL17783-PA 226 GL17783-PA 4..224 20..240 617 51.1 Plus
Dper\GL17770-PA 222 GL17770-PA 1..217 18..233 471 44.7 Plus
Dper\GL17771-PA 221 GL17771-PA 1..215 18..233 464 45.2 Plus
Dper\GL17773-PA 222 GL17773-PA 1..214 18..231 462 45.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14226-PA 223 GA14226-PA 1..223 18..240 1128 92.8 Plus
Dpse\GA18748-PA 226 GA18748-PA 4..224 20..240 619 51.6 Plus
Dpse\GA14541-PA 222 GA14541-PA 1..217 18..233 475 44.7 Plus
Dpse\GA14545-PA 222 GA14545-PA 1..214 18..231 470 46.5 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..215 18..233 465 45.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11796-PA 223 GM11796-PA 1..223 18..240 1172 98.7 Plus
Dsec\GM21891-PA 225 GM21891-PA 3..225 19..240 566 49.3 Plus
Dsec\GM21879-PA 222 GM21879-PA 1..216 18..233 502 45.6 Plus
Dsec\GM21878-PA 219 GM21878-PA 1..216 18..234 492 46.5 Plus
Dsec\GM21875-PA 221 GM21875-PA 4..217 20..234 466 47 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24922-PA 213 GD24922-PA 1..213 18..240 1060 91.5 Plus
Dsim\GD11373-PA 222 GD11373-PA 1..216 18..233 500 45.6 Plus
Dsim\GD11388-PA 251 GD11388-PA 48..251 38..240 493 46.6 Plus
Dsim\GD11372-PA 219 GD11372-PA 1..216 18..234 488 46.5 Plus
Dsim\GD25394-PA 240 GD25394-PA 6..224 23..240 464 44.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21084-PA 223 GJ21084-PA 1..223 18..240 1055 87 Plus
Dvir\GJ19903-PA 228 GJ19903-PA 5..228 16..239 609 50.9 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..213 18..231 514 50.5 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 1..219 18..236 482 45 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 1..216 18..233 479 46.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21654-PA 223 GK21654-PA 1..223 18..240 1031 85.2 Plus
Dwil\GK23004-PA 226 GK23004-PA 4..223 20..238 603 53.6 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..216 18..233 518 47 Plus
Dwil\GK22985-PA 219 GK22985-PA 1..217 18..235 462 45.4 Plus
Dwil\GK22984-PA 220 GK22984-PA 1..215 18..233 453 44 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11420-PA 223 GE11420-PA 1..223 18..240 1160 97.3 Plus
Dyak\GE11975-PA 225 GE11975-PA 3..225 19..240 572 50.7 Plus
Dyak\GE11961-PA 222 GE11961-PA 1..216 18..233 508 45.6 Plus
Dyak\GE11960-PA 219 GE11960-PA 1..216 18..234 490 47.5 Plus
Dyak\GE11964-PA 222 GE11964-PA 1..215 18..233 474 47.9 Plus