Clone MIP17260 Report

Search the DGRC for MIP17260

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:172
Well:60
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG7777-RC
Protein status:MIP17260.pep: gold
Sequenced Size:1499

Clone Sequence Records

MIP17260.complete Sequence

1499 bp assembled on 2010-01-28

GenBank Submission: BT120265.1

> MIP17260.complete
AGTTTTTGTCGTCGAGTCAAAGTGCGCGGATCACTCCTCGAGTGAGCTAA
CAATTCCTGCCGAATTGAATTAAATATTTGTTAAGTGCAAGTTAAGGTGT
TAGCTGTTGTTGTTGCCGTTAAGTCGAGTTCGTAAGCAGGTGGCAAAGGT
GCCAAAGTGAGCTAATAGCAAAACAAGTCCGTCAGTTTTAGTTGAAAAGT
GAAGCGAAGAAGATGGGAAAATTCGAATACTCACTGGGTCTCAATGAGCT
CAAATCCAAGGAGCTGCGATTGTGGCAGGCCTTGATTGGAGAATTCCTTG
GCAATTTGATCCTCAATTTCTTTGCCTGCGGCGCATGCACCCAAATTGAG
GATGGCACCTTCAAGGCCTTGGCTTTTGGCCTGGCTATCTTCATGGCCAT
CACGATTGTGGGCCACTTGAGTGGTGGTCATGTGAATCCTGCCGTTACCG
CTGGAATGTTGGTCGCAGGACGAATTAGCTTGATCAGAGCCTTTTTCTAT
GTGGTTTTCCAGTGCTTGGGTGCAATTGCCGGAACTGCAGCGGTTAAGAT
TCTCATCGATCAGGACTATTACAATGGCCTGGGTCACACCTCTCTGGCGC
CCAATATCACCGAGCTGCAGGGCCTGGGAATCGAGTTCTTCCTGGGACTC
CTGCTGGTGCTCGTCGTCTTTGGGGCCTGTGATCCCCACAAGCCCGATTC
CCGCTACACGGCGCCCTTGGCCATCGGAATGGCGGTGACCCTGGGTCACT
TGGGCACCATCCGCTACACCGGGGCCAGCATGAATCCCGCTCGCACCGTG
GGCACCGCCTTTGCCACCGACATCTGGGCGTCGCATTGGGTATACTGGGT
GGGACCTGTGCTGGGGGGCGTGGCTGCCGCCCTGCTCTACACCCAGGTCC
TGGAGGCGAAGCCCGTGCCAAAGGTTAACGAGGCATCCGAGAAGTACCGA
ACGCACGCCGATGAACGCGAGGGATGCAAACCGAACCACAACCCGAACCA
TTTGGCATATACATATCTCGCTTAACTATAACTATTAAATGTGTTATGTT
TTATCGCTTTAGCAGCAGATATTCGTATACTAAAGATATTACGACCTGCA
CGCAAAACTAATCTAAACCGCTTTTGTGAACCGAATACGATTGGTTTAGA
AACTCTTCAATCCTATCAACCGAACCCGTCCGCCATTTCGATCGATGCGC
AAACTGGAGGGAGCCCGTGACTACGCCTAGATATAAAGAAATCTTTGCGA
CTCGAATCTAGGGATACAGATGAAATCTGTGTGTTTAATCCATTCATTTC
AGTGTCTAACATAAACATGTCGTGTTCTTCTACGTTCGTGTGTATTTATG
TATTTATTCATGCAAAATTCATTTTTAACTAACTAATATTTAATGTGTAA
GCTGCCCTAAAATGCAATCTACAACAAAATTACTTGTACTCTCATGCGCT
CACAATAAAGTGGAAAACATTAACTAAAAAAAAAAAAAAAAAAAAAAAA

MIP17260.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-RB 1429 CG7777-RB 40..1011 1..972 4860 100 Plus
CG7777-RA 1369 CG7777-RA 109..1079 1..971 4855 100 Plus
CG7777.a 1152 CG7777.a 70..863 178..971 3970 100 Plus
CG7777-RA 1369 CG7777-RA 1079..1368 1194..1483 1420 99.3 Plus
CG7777.a 1152 CG7777.a 863..1152 1194..1483 1420 99.3 Plus
CG7777-RB 1429 CG7777-RB 1141..1429 1195..1483 1415 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7328546..7328971 547..972 2115 99.8 Plus
chr2R 21145070 chr2R 7329414..7329695 1194..1475 1410 100 Plus
chr2R 21145070 chr2R 7329128..7329352 970..1194 1125 100 Plus
chr2R 21145070 chr2R 7323724..7323900 1..177 885 100 Plus
chr2R 21145070 chr2R 7327448..7327605 247..404 745 98.1 Plus
chr2R 21145070 chr2R 7327666..7327810 404..548 725 100 Plus
chr2R 21145070 chr2R 7327276..7327348 176..248 335 97.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-RC 813 CG7777-PC 1..813 213..1025 4065 100 Plus
CG7777-RB 807 CG7777-PB 1..760 213..972 3800 100 Plus
CG7777-RD 780 CG7777-PD 1..759 213..971 3795 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:21:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-RC 1479 CG7777-RC 4..1478 1..1475 7375 100 Plus
CG7777-RB 1386 CG7777-RB 4..975 1..972 4860 100 Plus
CG7777-RD 1388 CG7777-RD 4..974 1..971 4855 100 Plus
CG7777-RB 1386 CG7777-RB 1105..1385 1195..1475 1405 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-PC 270 CG7777-PC 1..263 213..1001 1264 100 Plus
CG7777-PD 259 CG7777-PD 1..253 213..971 1196 100 Plus
CG7777-PA 264 CG7777-PA 1..253 213..971 1196 100 Plus
CG7777-PB 268 CG7777-PB 1..253 213..971 1196 100 Plus
Drip-PB 245 CG9023-PB 3..234 201..911 434 40.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11441066..11441491 547..972 2130 100 Plus
2R 25286936 2R 11441934..11442223 1194..1483 1420 99.3 Plus
2R 25286936 2R 11441648..11441872 970..1194 1125 100 Plus
2R 25286936 2R 11436246..11436422 1..177 885 100 Plus
2R 25286936 2R 11439968..11440125 247..404 790 100 Plus
2R 25286936 2R 11440186..11440330 404..548 725 100 Plus
2R 25286936 2R 11439796..11439868 176..248 365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11442265..11442690 547..972 2130 100 Plus
2R 25260384 2R 11443133..11443422 1194..1483 1420 99.3 Plus
2R 25260384 2R 11442847..11443071 970..1194 1125 100 Plus
2R 25260384 2R 11437445..11437621 1..177 885 100 Plus
2R 25260384 2R 11441167..11441324 247..404 790 100 Plus
2R 25260384 2R 11441385..11441529 404..548 725 100 Plus
2R 25260384 2R 11440995..11441067 176..248 365 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:45:06 has no hits.

MIP17260.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:30:09 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7329415..7329695 1195..1475 100   Plus
chr2R 7329130..7329352 972..1194 100 -> Plus
chr2R 7328548..7328970 549..971 99 -> Plus
chr2R 7327667..7327810 405..548 100 -> Plus
chr2R 7327450..7327605 249..404 98 -> Plus
chr2R 7327278..7327348 178..248 97 -> Plus
chr2R 7323724..7323900 1..177 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 16:04:22 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 1..760 213..972 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:07 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 1..813 213..1025 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:59 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 1..813 213..1025 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:09 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 1..813 213..1025 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 16:04:19 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 1..972 1..972 100 == Plus
CG7777-RB 1102..1382 1195..1475 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:07 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 1..1475 1..1475 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:59 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 4..1478 1..1475 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:09 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RC 4..1478 1..1475 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:30:09 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11441935..11442215 1195..1475 100   Plus
2R 11441650..11441872 972..1194 100 -> Plus
2R 11441068..11441490 549..971 100 -> Plus
2R 11440187..11440330 405..548 100 -> Plus
2R 11439970..11440125 249..404 100 -> Plus
2R 11439798..11439868 178..248 100 -> Plus
2R 11436246..11436422 1..177 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:59 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7329440..7329720 1195..1475 100   Plus
arm_2R 7329155..7329377 972..1194 100 -> Plus
arm_2R 7328573..7328995 549..971 100 -> Plus
arm_2R 7327692..7327835 405..548 100 -> Plus
arm_2R 7327475..7327630 249..404 100 -> Plus
arm_2R 7327303..7327373 178..248 100 -> Plus
arm_2R 7323751..7323927 1..177 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:32 Download gff for MIP17260.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11443134..11443414 1195..1475 100   Plus
2R 11442849..11443071 972..1194 100 -> Plus
2R 11442267..11442689 549..971 100 -> Plus
2R 11441386..11441529 405..548 100 -> Plus
2R 11441169..11441324 249..404 100 -> Plus
2R 11440997..11441067 178..248 100 -> Plus
2R 11437445..11437621 1..177 100 -> Plus

MIP17260.pep Sequence

Translation from 212 to 1024

> MIP17260.pep
MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTF
KALAFGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQ
CLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEFFLGLLLVL
VVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF
ATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHAD
EREGCKPNHNPNHLAYTYLA*

MIP17260.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12555-PA 264 GF12555-PA 1..253 1..253 1235 89.7 Plus
Dana\GF12394-PA 245 GF12394-PA 7..243 1..245 458 38.9 Plus
Dana\GF11831-PA 272 GF11831-PA 20..264 12..246 355 33.5 Plus
Dana\GF11832-PA 266 GF11832-PA 13..264 13..250 317 31.3 Plus
Dana\GF12392-PA 100 GF12392-PA 3..98 109..240 307 50.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20203-PA 264 GG20203-PA 1..253 1..253 1322 99.6 Plus
Dere\GG22646-PA 245 GG22646-PA 7..243 1..245 461 39.3 Plus
Dere\GG20011-PA 271 GG20011-PA 32..262 26..246 354 34.6 Plus
Dere\GG20012-PA 294 GG20012-PA 42..287 13..252 318 30.8 Plus
Dere\GG10075-PA 694 GG10075-PA 60..280 16..233 292 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21387-PA 264 GH21387-PA 1..253 1..253 1160 85.4 Plus
Dgri\GH20503-PA 247 GH20503-PA 17..245 15..245 424 38.2 Plus
Dgri\GH21220-PA 267 GH21220-PA 18..267 12..251 317 32 Plus
Dgri\GH21219-PA 246 GH21219-PA 1..244 13..252 285 30.3 Plus
Dgri\GH21221-PA 259 GH21221-PA 25..257 24..260 282 29.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-PC 270 CG7777-PC 1..270 1..270 1415 100 Plus
CG7777-PD 259 CG7777-PD 1..253 1..253 1312 100 Plus
CG7777-PA 264 CG7777-PA 1..253 1..253 1312 100 Plus
CG7777-PB 268 CG7777-PB 1..253 1..253 1312 100 Plus
Drip-PE 239 CG9023-PE 1..228 1..233 473 40.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18564-PA 264 GI18564-PA 1..253 1..253 1156 83.8 Plus
Dmoj\GI21049-PA 247 GI21049-PA 7..245 1..245 443 37.7 Plus
Dmoj\GI20505-PA 274 GI20505-PA 23..254 12..233 311 31.5 Plus
Dmoj\GI20506-PA 247 GI20506-PA 16..236 24..234 299 33.5 Plus
Dmoj\GI20504-PA 249 GI20504-PA 1..245 13..250 282 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11410-PA 123 GL11410-PA 1..113 1..113 545 91.2 Plus
Dper\GL17597-PA 272 GL17597-PA 12..265 4..247 329 32.7 Plus
Dper\GL17598-PA 266 GL17598-PA 14..264 13..253 312 30.4 Plus
Dper\GL17596-PA 249 GL17596-PA 1..245 13..250 291 31 Plus
Dper\GL18952-PA 691 GL18952-PA 58..278 16..233 288 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20580-PA 264 GA20580-PA 1..253 1..253 1242 91.7 Plus
Dpse\GA24443-PA 244 GA24443-PA 7..241 1..243 438 39.6 Plus
Dpse\GA24837-PA 273 GA24837-PA 18..266 9..247 322 32.1 Plus
Dpse\GA24838-PA 266 GA24838-PA 14..264 13..253 315 30.4 Plus
Dpse\GA17871-PA 249 GA17871-PA 1..245 13..250 291 31 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21291-PA 264 GM21291-PA 1..253 1..253 1325 100 Plus
Dsec\GM20426-PA 245 GM20426-PA 7..243 1..245 456 38.9 Plus
Dsec\GM15523-PA 274 GM15523-PA 32..266 26..246 336 33.6 Plus
Dsec\GM15524-PA 265 GM15524-PA 13..258 13..244 295 30.1 Plus
Dsec\GM17851-PA 684 GM17851-PA 60..280 16..233 285 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10798-PA 264 GD10798-PA 1..253 1..253 1325 100 Plus
Dsim\GD25027-PA 265 GD25027-PA 32..257 26..246 347 35 Plus
Dsim\GD25028-PA 265 GD25028-PA 13..258 13..244 295 30.1 Plus
Dsim\GD23647-PA 674 GD23647-PA 60..280 16..233 292 34.5 Plus
Dsim\GD25026-PA 261 GD25026-PA 12..257 12..250 277 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20358-PA 264 GJ20358-PA 1..253 1..253 1161 87 Plus
Dvir\GJ21971-PA 305 GJ21971-PA 69..303 8..245 452 38.8 Plus
Dvir\GJ22357-PA 247 GJ22357-PA 13..240 24..245 286 29.7 Plus
Dvir\bib-PA 700 GJ17924-PA 58..278 16..233 276 33.6 Plus
Dvir\GJ22355-PA 252 GJ22355-PA 1..221 13..226 272 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21417-PA 264 GK21417-PA 1..253 1..253 1210 88.9 Plus
Dwil\GK21884-PA 245 GK21884-PA 7..243 1..245 425 36.4 Plus
Dwil\GK23178-PA 270 GK23178-PA 16..265 13..253 322 31.9 Plus
Dwil\GK23177-PA 262 GK23177-PA 19..253 23..247 316 33.6 Plus
Dwil\GK23174-PA 249 GK23174-PA 1..245 13..250 309 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12363-PA 264 GE12363-PA 1..253 1..253 1214 96.8 Plus
Dyak\GE13520-PA 245 GE13520-PA 7..243 1..245 473 39.7 Plus
Dyak\GE11548-PA 271 GE11548-PA 32..262 26..246 364 35.5 Plus
Dyak\GE11549-PA 265 GE11549-PA 13..258 13..252 319 29.6 Plus
Dyak\GE18888-PA 699 GE18888-PA 60..280 16..233 293 34.5 Plus

MIP17260.hyp Sequence

Translation from 212 to 1024

> MIP17260.hyp
MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTF
KALAFGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQ
CLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEFFLGLLLVL
VVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF
ATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHAD
EREGCKPNHNPNHLAYTYLA*

MIP17260.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-PC 270 CG7777-PC 1..270 1..270 1415 100 Plus
CG7777-PD 259 CG7777-PD 1..253 1..253 1312 100 Plus
CG7777-PA 264 CG7777-PA 1..253 1..253 1312 100 Plus
CG7777-PB 268 CG7777-PB 1..253 1..253 1312 100 Plus
Drip-PE 239 CG9023-PE 1..228 1..233 473 40.4 Plus