Clone MIP20740 Report

Search the DGRC for MIP20740

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:207
Well:40
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptsm-RJ
Protein status:MIP20740.pep: gold
Sequenced Size:2375

Clone Sequence Records

MIP20740.complete Sequence

2375 bp assembled on 2010-04-12

GenBank Submission: BT124736.1

> MIP20740.complete
AGTACACCTAGGAATACTCAATCCACAAATATATAAAATAAAAAAATCAC
AAAAAAAACTGAACATAAAATTTGTGTTGTGTGTTACATTAAACAGTGTT
AACTTTTACCGTGTTACCGACAATTGCTTCATTGCGTACATTGGCTTCGT
GTTAACTAGTTGATTTTCGGCTGCCCAGAATTAACCCTTAAAGAATCTTT
CTAACAATTTTCACTGCCGATCGAGTGGTTCTGATTTGTGGCCTTAAGAC
CCAATTAAATCAAGTTGCTGCAGCATGAATAACCTGAACGCGAATGCCAG
TGCCTTTTTGTGGCAGGTACCGCCGCCGCAGCAGTTGACCCCTCAATCGG
TGCAGCAGCAGACGGTGCAGTCGGTGCAGTCCATGCAGTCCGTGCAGCAT
AGCCAGCTGCTTCAATCCGCTGTAGTCTCGCAGCCGCGCAAGTTTGGTGG
CAACAAGAGCAACTATAACTACATGCAGAATCATGCCATTATGGGTCCGG
GCGGCGGTCCAATGGGTGGGATCGGTGGCAACCCTAACATCTACCGAAAG
CGCCATTCTATCAACACCTACAATGCTGGCTTATATCAAACCAATGTAGC
AACACTGTCGACACCACAACAACATGTTTCCCATCAACACCACCACCACC
TCCGCCAACAACAACAACAACAACATCAACAACAAGCACCACAACAACAA
CCACATCCACAACACCTTCACCACCAACAACAACTAGTTGCCCCAGCTCA
ATCGCACAATCTTTATCAATTTAAAGAACCACCGCTATTGGGACCCGGAG
CCGCTTTCCCACCATTCGGAGCTCCCGAATATCACACCACCACACCGGAG
AACTGGAAGGGGGCCGCCATCCATCCCACTGGCCTGATGAAGGAGCCCGC
TGGTGTTGTGCCCGGACGCAATGCTCCGGTGGCCTTCACACCGCAAGGAC
AGGCTCAGGGCGCCGTCATGATGGTCTACGGCCTGGACCACGACACTTCC
AACACGGATAAGCTCTTCAATTTGGTTTGCCTGTACGGCAACGTGGCACG
GATCAAGTTCTTGAAGACCAAAGAGGGCACCGCCATGGTGCAAATGGGAG
ACGCTGTGGCCGTTGAGCGTTGCGTGCAGCACTTGAACAACATTCCCGTG
GGCACTGGTGGCAAGATACAGATCGCTTTCTCCAAACAGAACTTCCTATC
CGAGGTGATCAACCCGTTCTTGCTGCCCGATCATTCGCCCAGCTTCAAGG
AGTACACCGGCTCCAAGAACAATCGTTTCCTATCGCCGGCCCAGGCGAGC
AAGAATCGCATTCAACCACCGAGCAAGATTTTGCACTTTTTCAACACACC
GCCCGGCTTGACCGAGGACCAACTGATTGGAATCTTTAACATCAAGGATG
TGCCCGCCACATCGGTGCGCCTGTTCCCCTTGAAGACCGAGCGCTCGTCG
TCGGGACTGATCGAATTTTCCAATATCTCGCAGGCAGTGCTGGCTATCAT
GAAGTGCAACCATCTGCCTATTGAGGGTAAAGGCACCAAGTTCCCATTCA
TCATGAAGCTGTGCTTTTCCTCATCCAAGAGCATGAACGGCGCCTGGAAC
AATGCGGCCAGCGAGGGCATGATCGAGAAGGAGAACGAGGTGGATACCAA
GGTGGACATCTACAATTGAGATTTGATTACGATTGTGTAAGCAAGCAAAC
AACAACCGGCTTAACTAGAACACAATACAGAACAACACTGGGGATATGGG
TCGCAAACAACGTGCAGAAGACAACAGCAACAGCAAAATCAGCAACAAAT
GCGTCACCAACTGCACCAAATGCTGAAACTTCAACTACAGATCCACTACG
ATCCACCAACTTGATGGCTTACACATTCGACAAGAAAAGCGGGAATTTCA
AACAAATTGATTGCTAAATCAATTAAACAAACCAACAAAAAATGAAATGA
TAAATGATAAACATTCAAGAAAAAGGAATTACACTTAGGCGCAAACGCAT
GTAACTTTTCTACGAGCCATTTGCATAGATTTACTGAATTCCACCATATA
TCAATTCAGCTAGTTAGTATGACAGCCTATGTACGATATGGCCTCGTTTA
AAAGCCACACCAAAAGAAAACACACTTAATGCACATTACATTACATTGAA
TTACATGCGTTTGCGTTGCAACAAAACAAGCAAAATAATACAAAAAAAAA
TAATTGTTATTATTGTTACAATGAAGCATTAGGACTTTCTCACACAACAG
CAAAAAAAATGGAATCACTCCAACCAATTGTAAACTATGTATTGTTTAAT
TGATAAAAAACGACAAACTAAACCAAAAATAAATAATTGTAATTCAAAAC
TCAACAAAAAAAAAAAAAAAAAAAA

MIP20740.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
sm.l 3697 sm.l 669..2247 776..2354 7895 100 Plus
sm.i 2603 sm.i 669..2247 776..2354 7895 100 Plus
sm.j 2482 sm.j 655..2232 777..2354 7890 100 Plus
sm.l 3697 sm.l 74..669 1..596 2980 100 Plus
sm.i 2603 sm.i 74..669 1..596 2980 100 Plus
sm.j 2482 sm.j 11..606 1..596 2980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15417054..15417878 2354..1531 4030 99.5 Minus
chr2R 21145070 chr2R 15433668..15434263 596..1 2965 99.8 Minus
chr2R 21145070 chr2R 15425214..15425577 959..596 1820 100 Minus
chr2R 21145070 chr2R 15419611..15419887 1327..1051 1385 100 Minus
chr2R 21145070 chr2R 15419345..15419552 1533..1326 1040 100 Minus
chr2R 21145070 chr2R 15424961..15425057 1051..955 485 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
sm-RJ 1395 CG9218-PJ 1..1395 275..1669 6975 100 Plus
sm-RT 1659 CG9218-PT 586..1659 596..1669 5370 100 Plus
sm-RK 1608 CG9218-PK 535..1608 596..1669 5370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:23:28 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
sm-RJ 2379 CG9218-RJ 28..2379 1..2352 11760 100 Plus
sm-RT 3226 CG9218-RT 1498..3226 596..2324 8645 100 Plus
sm-RK 3175 CG9218-RK 1447..3175 596..2324 8645 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
sm-PJ 464 CG9218-PJ 1..464 275..1666 1689 100 Plus
sm-PK 535 CG9218-PK 231..535 752..1666 1502 100 Plus
sm-PV 540 CG9218-PV 236..540 752..1666 1502 100 Plus
sm-PT 552 CG9218-PT 248..552 752..1666 1502 100 Plus
sm-PAC 301 CG9218-PAC 22..301 827..1666 1468 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19529879..19530702 2354..1531 4120 100 Minus
2R 25286936 2R 19546449..19547044 596..1 2980 100 Minus
2R 25286936 2R 19538029..19538392 959..596 1820 100 Minus
2R 25286936 2R 19532436..19532712 1327..1051 1385 100 Minus
2R 25286936 2R 19532169..19532376 1533..1326 1040 100 Minus
2R 25286936 2R 19537776..19537872 1051..955 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19531078..19531901 2354..1531 4120 100 Minus
2R 25260384 2R 19547648..19548243 596..1 2980 100 Minus
2R 25260384 2R 19539228..19539591 959..596 1820 100 Minus
2R 25260384 2R 19533635..19533911 1327..1051 1385 100 Minus
2R 25260384 2R 19533368..19533575 1533..1326 1040 100 Minus
2R 25260384 2R 19538975..19539071 1051..955 485 100 Minus
Blast to na_te.dros performed 2014-11-27 14:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2527..2719 1698..1888 222 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2446 1700..1839 149 60.8 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3285..3374 1758..1852 147 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2367..2454 1765..1853 145 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6762..6850 1756..1840 138 65.2 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 5195..5299 2100..2204 138 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2292..2453 1740..1907 133 57.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6805 1772..1840 129 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6825 1756..1839 125 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6872..6923 1765..1817 118 71.7 Plus

MIP20740.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:35:40 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15433668..15434263 1..596 96   Minus
chr2R 15425518..15425576 597..655 100 <- Minus
chr2R 15425215..15425438 735..958 100 == Minus
chr2R 15424961..15425053 959..1051 100 <- Minus
chr2R 15419611..15419886 1052..1327 100 <- Minus
chr2R 15419346..15419550 1328..1532 100 <- Minus
chr2R 15417053..15417876 1533..2355 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-29 18:26:59 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RA 534..1428 775..1669 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:54:52 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 1..1395 275..1669 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:09:53 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 1..1395 275..1669 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:40 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 1..1395 275..1669 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-29 18:26:58 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RF 1440..3017 775..2352 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:54:51 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 11..1946 1..1936 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:09:53 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 28..2379 1..2352 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:40 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
sm-RJ 28..2379 1..2352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:35:40 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19546449..19547044 1..596 100   Minus
2R 19538030..19538391 597..958 100 <- Minus
2R 19537776..19537868 959..1051 100 <- Minus
2R 19532436..19532711 1052..1327 100 <- Minus
2R 19532170..19532374 1328..1532 100 <- Minus
2R 19529878..19530700 1533..2355 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:09:53 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15433954..15434549 1..596 100   Minus
arm_2R 15425535..15425896 597..958 100 <- Minus
arm_2R 15425281..15425373 959..1051 100 <- Minus
arm_2R 15419941..15420216 1052..1327 100 <- Minus
arm_2R 15419675..15419879 1328..1532 100 <- Minus
arm_2R 15417383..15418205 1533..2355 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:46:31 Download gff for MIP20740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19547648..19548243 1..596 100   Minus
2R 19539229..19539590 597..958 100 <- Minus
2R 19538975..19539067 959..1051 100 <- Minus
2R 19533635..19533910 1052..1327 100 <- Minus
2R 19533369..19533573 1328..1532 100 <- Minus
2R 19531077..19531899 1533..2355 99 <- Minus

MIP20740.pep Sequence

Translation from 274 to 1668

> MIP20740.pep
MNNLNANASAFLWQVPPPQQLTPQSVQQQTVQSVQSMQSVQHSQLLQSAV
VSQPRKFGGNKSNYNYMQNHAIMGPGGGPMGGIGGNPNIYRKRHSINTYN
AGLYQTNVATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHH
QQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIH
PTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNL
VCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQI
AFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPS
KILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSN
ISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMI
EKENEVDTKVDIYN*

MIP20740.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:29:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13176-PA 421 GF13176-PA 1..421 1..464 1710 75.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20899-PA 423 GG20899-PA 11..423 11..464 1807 81 Plus
Dere\GG11844-PA 800 GG11844-PA 599..783 223..413 175 26 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22768-PA 482 GH22768-PA 186..482 168..464 1507 93.6 Plus
Dgri\GH17472-PA 920 GH17472-PA 727..903 231..413 183 27.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
sm-PJ 464 CG9218-PJ 1..464 1..464 2469 100 Plus
sm-PI 420 CG9218-PI 1..420 1..464 2075 87.5 Plus
sm-PK 535 CG9218-PK 177..535 106..464 1901 99.4 Plus
sm-PT 552 CG9218-PT 196..552 108..464 1900 100 Plus
sm-PV 540 CG9218-PV 184..540 108..464 1899 99.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18546-PA 481 GI18546-PA 185..481 168..464 1514 93.9 Plus
Dmoj\GI22798-PA 834 GI22798-PA 633..829 223..425 184 26.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11734-PA 325 GL11734-PA 108..290 245..432 846 87.2 Plus
Dper\GL24102-PA 494 GL24102-PA 309..489 237..425 178 27.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30475-PE 514 GA30475-PE 1..514 1..464 1672 70.4 Plus
Dpse\GA30475-PD 428 GA30475-PD 1..428 1..464 1644 72.9 Plus
Dpse\GA30475-PC 352 GA30475-PC 42..352 154..464 1620 96.5 Plus
Dpse\GA30475-PB 412 GA30475-PB 112..412 164..464 1558 95.7 Plus
Dpse\GA30475-PA 498 GA30475-PA 202..498 168..464 1553 96.3 Plus
Dpse\GA30475-PB 412 GA30475-PB 1..67 1..70 153 57.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\sm-PA 420 GM19822-PA 1..420 1..464 1805 84.3 Plus
Dsec\GM16408-PA 792 GM16408-PA 599..775 231..413 174 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\sm-PA 388 GD25314-PA 195..388 168..361 1016 96.9 Plus
Dsim\GD16206-PA 792 GD16206-PA 599..775 231..413 174 26.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21415-PA 480 GJ21415-PA 185..480 168..464 1467 92.3 Plus
Dvir\GJ22800-PA 818 GJ22800-PA 555..813 154..425 185 25.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15699-PA 478 GK15699-PA 171..478 157..464 1558 93.8 Plus
Dwil\GK10936-PA 629 GK10936-PA 329..553 172..410 182 25.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13838-PA 491 GE13838-PA 195..491 168..464 1578 98.7 Plus
Dyak\GE23291-PA 802 GE23291-PA 601..785 223..413 180 26.5 Plus

MIP20740.hyp Sequence

Translation from 274 to 1668

> MIP20740.hyp
MNNLNANASAFLWQVPPPQQLTPQSVQQQTVQSVQSMQSVQHSQLLQSAV
VSQPRKFGGNKSNYNYMQNHAIMGPGGGPMGGIGGNPNIYRKRHSINTYN
AGLYQTNVATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHH
QQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIH
PTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNL
VCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQI
AFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPS
KILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSN
ISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMI
EKENEVDTKVDIYN*

MIP20740.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
sm-PJ 464 CG9218-PJ 1..464 1..464 2469 100 Plus
sm-PI 420 CG9218-PI 1..420 1..464 2075 87.5 Plus
sm-PK 535 CG9218-PK 177..535 106..464 1901 99.4 Plus
sm-PT 552 CG9218-PT 196..552 108..464 1900 100 Plus
sm-PV 540 CG9218-PV 184..540 108..464 1899 99.7 Plus