Clone MIP21552 Report

Search the DGRC for MIP21552

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:215
Well:52
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG8197-RA
Protein status:MIP21552.pep: gold
Sequenced Size:3777

Clone Sequence Records

MIP21552.complete Sequence

3777 bp assembled on 2010-06-03

GenBank Submission: BT124985.1

> MIP21552.complete
GCTGGCTCAGTTGTCATAAATTCACAATAACTTTTAAATAGTTTAATTAT
TGATCTTATACACGATAGAGTTCAGGATGTGCGACGTGCTCCTCCCATGC
GAGTATAATCCAAAGGAATGTCCGAGTCCTGCGGCGGAGAAGAGCCGCCT
CTTCACGATCCTTTTGCTCTACTGTTGGCAGCGGGAGTACGATAAGAGAC
CCTACCGCCAGTTCCAGTTCAAGCGACTCACGTTCGAGGAACGGATTGGT
CGGAGGTACCACTGCATCCGTGACTTGCGGATCATCGTTAACTATCTGCT
GCGGCGTCCCCAGTTGTCTGTCCAAATTTCCAGCTTGGTTGTCAGCAACT
GGGATGCGGGCTTGCTGAAGGACTTTGTCCGCTCGCTGCTCCCCGTTTGG
TACATCGAGCTGCGACTGATGCGGTTTCCTCGGGAGTTCTTCGTGATGCT
GCGTCTCAATGCGGCCAAGATGAATGTTAGCCAGCTCAGCTTGGAAGGAA
CACCCCTCACCGATGAAGACGTGCGCATCCTGCGAGAATTCCTGCTGGTA
AGCAAGACTCTGCGCAGGCTCAACGTGTCCAGCTGCAGCCTGACACAGTT
CAACTTCGCTCTGATCGCGGACGGAGTGTATAAGTCGCCTGGAGTGCGAC
GCTTGAGCGCCAACCGGCTGCTGGGGATGAGCCTCAGCCTGGACACGGAG
AAAATTTCATCCGTGCTGAGCTCGCTGCTGATGCAGAATACACTCTGGGC
TCTTTCGCTGGAGCACTGCGAACTGACCGCCCAGGACATGATTCCCATTG
CCGAGCACCTGGCACGGACCAACTCGAAATTTCGGCGCCTGCGAATCGCC
TGCAACAAGATCGGTCCGGATGGAGCCTTCTTTCTGCTGCGTGGAATGTC
CATGGGTGGCAATCTGGAGTTGCTGGACCTGAGCTACTGCTCGATTGGTA
CGCACGGCGGCGAGTGGGTGGCCAAGTACCTGGCCTCGTGCCGCAGACTG
CAGGTCCTGCACTTGAACTACAACGACATGGGTCCGACGGCAGTGAATCT
CATCCTTCTGGCCATGAAGAAACAGTGCAAGCTGGAAAAACTAACCTTGT
ATGGCAACCACTTTGACTCGCGTACCGCGATGATAGTGCGTCGCTTGCTG
GATGCCGAGGTAGTACTCCACTCCGAGCTGGACATCAGTTACACATACGA
CGAGGCACTGCAGGATTACAGAGTGGTGCCTTGGCGTTAGAAAGTGGATA
GAAAGTTGTTAGTTGTGTTTACTCGCGGATGCTGGTACACATATTTATTC
AGCTACTGCTTATGGCCAGCCAACTACCCACCTAAACTAAACCGAAACCA
GAGCTAAAACTAAACTGAAAACGAAATCAAAACCAAAACTAACTAAACGA
ACTGAACTATAAAGAAGCCAGTGGCTGTTACAACTTTCACTACTAGCAAA
GTTGGACCAAAGGCAAAAGGCAAAAGCAGAAGCAACCCGACCAAGCAACA
TGAACATGAACATGAACGACAGTCGACGCAACACCGCCACGGAATTCAGC
TATATCCTGCAGCGCCAGAACAACCATCAGACACATCAGCAACAGGGCCA
GCCGCAACAGCCACATCAGCAGCAGCAGCAGCCGCCGCAGCAGCAGCAGC
AGCAACAGCATCGCCAGCATTCGCAGCAGCAGCAGCAAGCACAGCAGGAT
GCCGGACTGGGGGACACGCTGTCCTCGCTGCCACAGGCCTCGTTCAACTA
CATCAACTCCATCGTGGGCAGCGGCGTCATCGGCATACCCTACGCCCTTC
ACAGGGCCGGATTCGGACTGGGCCTGGCCCTGCTCATCCTGGTGGCCTAC
ATCACCGACTACTCACTCATCCTGATGGTGAGTGGCAGGCCCCCCTAACT
CGATGCCTTTCCCAAATCGGTTTTAAAGTTCCAATCAGGCAATCTGGACA
TCTGACCAGACCGAAGCGACCAAAGTCACATGCCAAACGCATTTCCGCTC
GACTCCGGGCATTAGCATTTGCTGCATAATTAACGAGCCCACTCATTTGC
GAGGGCGTGTGCTGCCGTTTAAGCCTCATTTCATTTGCAGGTCAGATGCG
GCCACATCTGCGGTCGGTTCAGCTATCCGGGCATCATGGAGGCGGCCTAC
GGCAAGTACGGCTATTACCTGCTCTCCCTGCTGCAGTTCATGTATCCATT
CCTGGCCATGATTTCCTACAACGTGGTGGTGGGCGATACGCTGTCGAAGG
TTCTGGTCCGCTTCTTCCCCTCCTGGGGCGGTTCCATGGGCGCCGTCCGA
CTGGGCGTGGTCTTCTTCGTCAACGTGGGCGTGGTGATGCCCCTCTGTCT
CTACAAGAACGTCTCCAGACTGGCCAGAGCCAGCTTCATTAGCCTGGCGT
GCGTGGTCTTCATCCTGTTTGCCGTCATCATCAAGCTCATGTCGGGCGAT
TATAAGGTGCGACCTGCTGGAGAACTACTGCTGGGATGACGACCTGATGA
ACTTCTCGCGTGTGCTCTTCTCCATATCGATACTCCTGACCTTCCCCATC
GAGTGCTTCGTGTCCCGCGAGATTGTGCGCGCCCTCGTCCATCGGTTCGT
GCTGAAGGAGCCCATCAGCGAGTTCACCCAGGACAAGGACCCCAGCCTGG
AGAAGGGGGCCATTATCGATGAGTACTCGAAAGCCATTACCATGGCCATC
GTGTTCAGCGCCTTCGTCATCTCGCCCATGACCGACTGCCTGGGTTCGGT
GCTGGAGCTGAATGGTCTCCTGGCGGCCATTCCCCTGGCCTACATCCTGC
CCGGCCTGGCCTACATTCAGATGGAGCCGCACGCCCTGCTCAGCCGGGAG
AAGCTGCCCGCTCTGGGCCTGGTGGTCTTCGGAGCCCTGGTGACCATCTT
GGGGGCGGCGGTGCTCCTGCCGGGTCTAATGGGCGGCGACTGCCGATCGG
ACATTGTGATGGGTTACTGCCGGCAGGAGTTTCAGAACACCACCTCCTCG
AACTAAGTTAACGGAACGGAAGTCAGCCCACGATGTGGGGCGCGCGGGTT
GGGATCGCATTTTTATGGTTTGGGTTTTTGGGTTGAAACTTCTGATTTGA
CCTTCGGTTAATACAGCTGCACCACGTCGCATCGAAAGAAACTTGTACCT
GAGTCCCAGACGTTCAAAGTATCTGCGTAAGTAAGTAGTAGGCACAGTGT
TGAATTGGATTAGTGGATAGCGGATAGCGGATGTGTGATACGGGCGAACC
TCAGTACAAAGGCCAGGCATTCTCTCCGATCGAGTAACCCATGTATATTT
GCACCGGATAGTCGTTTAAAGTGTACATTTCGTTGGATCCCCGTTGTTGA
TGTCGATATTGTTGAAAGTAGTGAAAGTTCCTCGATATATAAGTGTGTGT
GTACTCCGTACTCTGTACTTTGAAGCCATCAAGTTGAGCAAGCGATTTGA
ATTGAATTGAATCGAAAGAAACGAGCAAAGGCAAACTAAACCGAACTAGA
ACTAGATGTTATCCGTAGCTTTAGCGTAGTCTGAAACTATTTGGGCACCA
ATATACACATGCAATCCTTAGAGACAACCGACTCCCCAAGTTGAGAAGTG
AATCAAAATCGAAAACGAAATCGAACAAGTATTATATGTATGTACCGAGA
ACTATTTGTAACTATGTATGCCCCGACGTTACCGGATCGTATTCCCCAGT
TTTATATGTATGTATATGTATACAAGGGTAGATAAAAATGCGCTTGAACC
GAACTAAAATCAAACTACAATATATCC

MIP21552.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13743-RA 3531 CG13743-RA 1328..2646 2459..3777 6595 100 Plus
CG8197-RA 1467 CG8197-RA 66..1340 1..1275 6375 100 Plus
CG13743-RA 3531 CG13743-RA 726..1095 2090..2459 1850 100 Plus
CG13743-RA 3531 CG13743-RA 416..728 1567..1879 1565 100 Plus
CG13743-RA 3531 CG13743-RA 64..357 1275..1568 1470 100 Plus
tna.a 3629 tna.a 673..729 1598..1654 195 89.4 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4933301..4934320 3777..2764 4795 98.3 Minus
chr2R 21145070 chr2R 4948173..4948952 1275..496 3900 100 Minus
chr2R 21145070 chr2R 4938086..4938724 2205..1567 3195 100 Minus
chr2R 21145070 chr2R 4949024..4949521 498..1 2475 99.8 Minus
chr2R 21145070 chr2R 4946840..4947133 1568..1275 1470 100 Minus
chr2R 21145070 chr2R 4937450..4937704 2459..2205 1275 100 Minus
chr2R 21145070 chr2R 4935229..4935423 2764..2570 975 100 Minus
chr2R 21145070 chr2R 4935486..4935598 2571..2459 565 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG8197-RB 1164 CG8197-PB 1..1164 77..1240 5820 100 Plus
CG8197-RA 1164 CG8197-PA 1..1164 77..1240 5820 100 Plus
CG13743-RB 1527 CG13743-PB 980..1527 2459..3006 2740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13743-RC 3195 CG13743-RC 623..2310 2090..3777 8440 100 Plus
CG13743-RB 3463 CG13743-RB 1260..2578 2459..3777 6595 100 Plus
CG13743-RA 3523 CG13743-RA 1320..2638 2459..3777 6595 100 Plus
CG13743-RC 3195 CG13743-RC 1..625 1255..1879 3125 100 Plus
CG13743-RB 3463 CG13743-RB 56..660 1275..1879 3025 100 Plus
CG13743-RB 3463 CG13743-RB 658..1027 2090..2459 1850 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8197-PB 387 CG8197-PB 1..387 77..1237 1940 100 Plus
CG8197-PA 387 CG8197-PA 1..387 77..1237 1940 100 Plus
CG13743-PB 508 CG13743-PB 322..508 2443..3003 832 97.9 Plus
CG13743-PA 528 CG13743-PA 342..528 2443..3003 832 97.9 Plus
CG13743-PC 258 CG13743-PC 122..258 2076..2486 544 97.8 Plus
CG13743-PB 508 CG13743-PB 122..254 2076..2474 502 94.7 Plus
CG13743-PA 528 CG13743-PA 142..274 2076..2474 502 94.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:00:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9045735..9046748 3777..2764 5070 100 Minus
2R 25286936 2R 9060588..9061367 1275..496 3900 100 Minus
2R 25286936 2R 9050515..9051153 2205..1567 3195 100 Minus
2R 25286936 2R 9061439..9061936 498..1 2490 100 Minus
2R 25286936 2R 9059255..9059548 1568..1275 1470 100 Minus
2R 25286936 2R 9049879..9050133 2459..2205 1275 100 Minus
2R 25286936 2R 9047657..9047851 2764..2570 975 100 Minus
2R 25286936 2R 9047914..9048026 2571..2459 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9046934..9047947 3777..2764 5070 100 Minus
2R 25260384 2R 9061787..9062566 1275..496 3900 100 Minus
2R 25260384 2R 9051714..9052352 2205..1567 3195 100 Minus
2R 25260384 2R 9062638..9063135 498..1 2490 100 Minus
2R 25260384 2R 9060454..9060747 1568..1275 1470 100 Minus
2R 25260384 2R 9051078..9051332 2459..2205 1275 100 Minus
2R 25260384 2R 9048856..9049050 2764..2570 975 100 Minus
2R 25260384 2R 9049113..9049225 2571..2459 565 100 Minus
3L 28103327 3L 10863600..10863656 1598..1654 195 89.4 Plus
Blast to na_te.dros performed 2014-11-26 23:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 696..752 3760..3705 129 71.9 Minus

MIP21552.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:21:29 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4949025..4949521 1..497 99   Minus
chr2R 4948174..4948950 498..1274 100 <- Minus
chr2R 4947077..4947133 1275..1331 100 <- Minus
chr2R 4946840..4946998 1410..1568 100 == Minus
chr2R 4938693..4938722 1569..1598 100 <- Minus
chr2R 4938086..4938593 1698..2205 100 == Minus
chr2R 4937451..4937703 2206..2458 100 <- Minus
chr2R 4935486..4935598 2459..2571 100 <- Minus
chr2R 4935230..4935421 2572..2763 100 <- Minus
chr2R 4933301..4934320 2764..3777 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-29 18:28:46 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG8197-RA 1..1164 77..1240 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 22:00:45 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG8197-RA 1..1164 77..1240 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:29:55 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG8197-RA 1..1164 77..1240 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:21:29 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG8197-RA 1..1164 77..1240 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-29 18:28:45 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13743-RA 55..348 1275..1568 100 -> Plus
CG13743-RA 409..716 1569..1876 100 == Plus
CG13743-RA 717..1083 2090..2456 100 -> Plus
CG13743-RA 1319..2637 2457..3777 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 22:00:45 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13743-RA 1319..2637 2457..3777 99   Plus
CG13743-RA 717..1083 2090..2456 100 -> Plus
CG13743-RA 409..716 1569..1876 100 == Plus
CG13743-RA 55..348 1275..1568 100 -> Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:29:55 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13743-RC 623..2310 2090..3777 100   Plus
CG13743-RC 1..622 1255..1876 100 == Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:21:29 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
CG13743-RC 623..2310 2090..3777 100   Plus
CG13743-RC 1..622 1255..1876 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:21:29 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9061440..9061936 1..497 100   Minus
2R 9060589..9061365 498..1274 100 <- Minus
2R 9059255..9059548 1275..1568 100 <- Minus
2R 9050515..9051151 1569..2205 100 <- Minus
2R 9049880..9050132 2206..2458 100 <- Minus
2R 9047914..9048026 2459..2571 100 <- Minus
2R 9047658..9047849 2572..2763 100 <- Minus
2R 9045735..9046748 2764..3777 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:29:55 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4948945..4949441 1..497 100   Minus
arm_2R 4948094..4948870 498..1274 100 <- Minus
arm_2R 4946760..4947053 1275..1568 100 <- Minus
arm_2R 4938020..4938656 1569..2205 100 <- Minus
arm_2R 4937385..4937637 2206..2458 100 <- Minus
arm_2R 4935419..4935531 2459..2571 100 <- Minus
arm_2R 4935163..4935354 2572..2763 100 <- Minus
arm_2R 4933240..4934253 2764..3777 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:38:27 Download gff for MIP21552.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9062639..9063135 1..497 100   Minus
2R 9061788..9062564 498..1274 100 <- Minus
2R 9060454..9060747 1275..1568 100 <- Minus
2R 9051714..9052350 1569..2205 100 <- Minus
2R 9051079..9051331 2206..2458 100 <- Minus
2R 9049113..9049225 2459..2571 100 <- Minus
2R 9048857..9049048 2572..2763 100 <- Minus
2R 9046934..9047947 2764..3777 100 <- Minus

MIP21552.pep Sequence

Translation from 76 to 1239

> MIP21552.pep
MCDVLLPCEYNPKECPSPAAEKSRLFTILLLYCWQREYDKRPYRQFQFKR
LTFEERIGRRYHCIRDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDF
VRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVR
ILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLG
MSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNS
KFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAK
YLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRT
AMIVRRLLDAEVVLHSELDISYTYDEALQDYRVVPWR*

MIP21552.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12714-PA 386 GF12714-PA 1..386 1..387 1461 69.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10590-PA 387 GG10590-PA 1..387 1..387 1896 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20256-PA 385 GH20256-PA 1..385 1..387 1201 61.8 Plus
Dgri\GH12965-PA 280 GH12965-PA 35..280 142..387 772 60.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8197-PB 387 CG8197-PB 1..387 1..387 2002 100 Plus
CG8197-PA 387 CG8197-PA 1..387 1..387 2002 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19425-PA 384 GI19425-PA 1..384 1..387 1239 62 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16856-PA 386 GL16856-PA 1..386 1..387 1443 69 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20889-PA 386 GA20889-PA 1..386 1..387 1443 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20636-PA 387 GM20636-PA 1..387 1..387 2016 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10109-PA 387 GD10109-PA 1..387 1..387 2023 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22488-PA 385 GJ22488-PA 1..385 1..387 1207 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17808-PA 388 GK17808-PA 1..388 1..387 1238 59.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22620-PA 387 GE22620-PA 1..387 1..387 1937 92.8 Plus

MIP21552.hyp Sequence

Translation from 76 to 1239

> MIP21552.hyp
MCDVLLPCEYNPKECPSPAAEKSRLFTILLLYCWQREYDKRPYRQFQFKR
LTFEERIGRRYHCIRDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDF
VRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVR
ILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLG
MSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNS
KFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAK
YLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRT
AMIVRRLLDAEVVLHSELDISYTYDEALQDYRVVPWR*

MIP21552.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG8197-PB 387 CG8197-PB 1..387 1..387 2002 100 Plus
CG8197-PA 387 CG8197-PA 1..387 1..387 2002 100 Plus