Clone MIP22128 Report

Search the DGRC for MIP22128

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:221
Well:28
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptqjt-RA
Protein status:MIP22128.pep: gold
Sequenced Size:1010

Clone Sequence Records

MIP22128.complete Sequence

1010 bp assembled on 2010-04-26

GenBank Submission: BT124827.1

> MIP22128.complete
CCCGTTTTACAAATCGAAAAATTCGAACGAAACGAAAACCGAAAAATCTG
TGCTTTCGATTTAAGATCGATATCGTAAATTACGATAAATTCTCGATGAT
TCCAGTTTTTAAGCGATTACATTCCACGTGGCATTTGCTTAAAAACCTAA
TTTCAGGCTAGCCTAACTAACCATCAGTCTTGAACATTTGGCTTAAATAT
TCTGGATAAAATGGAATTCAATTACCTTGCTGATTCCGCACTTTCCACTT
TAGTGGAAAACAAAAAGTTCTTCAAGGAAATGTCAGATTTCGTGTCCGAT
TTCAGCGATGGCGGGAAGATCAAGAAGTTGCTCGAGCAGAGCGTTGAGCA
GAGCGTGGAGCACGCCGTGAATGTAGTCCATATGAAGATAAAGCACCAAT
CGCTCAACAAGGCTATGAATCAGGTCAAAAACTCTAGCGCCACCATCGAG
GAGTTCGAGGAAGTCTGGAAGGAACGCTCCAAAGCGGTGGAGCAGAAGCG
CATCAATGTCAAGAATCTACACGAGTTCAAGAACTTCGTAAAAGCAGTTG
AATCAGCAGCTGGTCAGGCGGGTGCGGAAGTCAATGATCAAGCGAATGGC
ACCGCCTATGATGAGGACCTTATTATGGAAGACTCCGGCAGCGAGGTCTT
CTCGTTCTACGATCCCTGGTCCAAGGCCCTGATAAAGAACCCCATGCGCA
ACAAAATGTGCGGTCACATCTACGACCGCGACTCGGTGATGCCGATCATA
ATGGACCGCATTGGCATCCGATGCCCGGTGCTCGGCTGCGCCAACTTGTG
CTACATCCAGCCAGATCACCTGGTCCAGGACGCCAATGTCCAGCAAAAGA
TACAACAGAGCATGTCTAACGCGATCGTGGATGTAACTGCCTCGGAGGAG
GACGAGGAATAGAACAGATAATGATTGTGCCCAACTCCGTCCTTGTTGAG
AATTAACTTAGTAAAATAAAATAAATTCATTGTTGCCATTAAAAAAAAAA
AAAAAAAAAA

MIP22128.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
qjt-RA 931 qjt-RA 9..931 1..923 4615 100 Plus
cerv-RA 1076 cerv-RA 550..894 565..909 960 85.2 Plus
cerv-RB 822 cerv-RB 296..640 565..909 960 85.2 Plus
cerv-RA 1076 cerv-RA 343..539 349..545 535 84.7 Plus
cerv-RB 822 cerv-RB 89..285 349..545 535 84.7 Plus
cerv-RA 1076 cerv-RA 213..350 207..344 390 85.5 Plus
cerv-RB 822 cerv-RB 42..96 290..344 155 85.4 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17468824..17469642 155..973 4065 99.8 Plus
chrX 22417052 chrX 15467054..15467605 909..349 1360 83.2 Minus
chr3L 24539361 chr3L 17468614..17468770 1..157 785 100 Plus
chrX 22417052 chrX 15464978..15465272 903..609 605 80.3 Minus
chrX 22417052 chrX 15445320..15445614 903..609 560 79.3 Minus
chrX 22417052 chrX 15465293..15465428 561..426 275 80.1 Minus
chrX 22417052 chrX 15445681..15445767 512..426 270 87.4 Minus
chrX 22417052 chrX 15467700..15467780 287..207 255 87.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
qjt-RB 702 CG13732-PB 1..702 211..912 3510 100 Plus
qjt-RA 702 CG13732-PA 1..702 211..912 3510 100 Plus
cerv-RD 693 CG15645-PD 1..678 211..909 1550 82.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
qjt-RA 990 CG13732-RA 1..990 1..990 4950 100 Plus
qjt-RB 834 CG13732-RB 1..834 157..990 4170 100 Plus
cerv-RD 1141 CG15645-RD 279..960 207..909 1570 82.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
qjt-PB 233 CG13732-PB 1..233 211..909 1197 100 Plus
qjt-PA 233 CG13732-PA 1..233 211..909 1197 100 Plus
cerv-PD 230 CG15645-PD 1..226 211..909 805 69.1 Plus
cerv-PA 230 CG15645-PA 1..226 211..909 805 69.1 Plus
cerv-PC 177 CG15645-PC 1..173 382..909 645 72.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17479306..17480142 155..991 4185 100 Plus
X 23542271 X 15577167..15577718 909..349 1360 83.2 Minus
3L 28110227 3L 17479096..17479252 1..157 785 100 Plus
X 23542271 X 15575060..15575354 903..609 605 80.3 Minus
X 23542271 X 15555366..15555660 903..609 560 79.3 Minus
X 23542271 X 15575375..15575510 561..426 275 80.1 Minus
X 23542271 X 15555727..15555813 512..426 270 87.4 Minus
X 23542271 X 15577813..15577893 287..207 255 87.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17472406..17473242 155..991 4185 100 Plus
X 23527363 X 15585265..15585609 909..565 960 85.2 Minus
3L 28103327 3L 17472196..17472352 1..157 785 100 Plus
X 23527363 X 15583158..15583452 903..609 605 80.3 Minus
X 23527363 X 15563464..15563758 903..609 560 79.3 Minus
X 23527363 X 15585620..15585816 545..349 535 84.7 Minus
X 23527363 X 15583473..15583608 561..426 275 80.1 Minus
X 23527363 X 15563825..15563911 512..426 270 87.3 Minus
X 23527363 X 15585911..15585991 287..207 255 87.6 Minus
X 23527363 X 15585809..15585863 344..290 155 85.4 Minus
Blast to na_te.dros performed on 2014-11-26 19:56:59 has no hits.

MIP22128.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:02:39 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17468826..17469671 157..990 98   Plus
chr3L 17468614..17468769 1..156 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 17:17:05 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..702 211..912 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:31:30 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..702 211..912 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:33 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..702 211..912 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:39 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..702 211..912 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 17:17:05 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..702 211..912 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:31:29 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..815 98..912 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:33 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..990 1..990 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:39 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
qjt-RA 1..990 1..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:02:39 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17479308..17480141 157..990 100   Plus
3L 17479096..17479251 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:33 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17472408..17473241 157..990 100   Plus
arm_3L 17472196..17472351 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:18 Download gff for MIP22128.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17472408..17473241 157..990 100   Plus
3L 17472196..17472351 1..156 100 -> Plus

MIP22128.pep Sequence

Translation from 210 to 911

> MIP22128.pep
MEFNYLADSALSTLVENKKFFKEMSDFVSDFSDGGKIKKLLEQSVEQSVE
HAVNVVHMKIKHQSLNKAMNQVKNSSATIEEFEEVWKERSKAVEQKRINV
KNLHEFKNFVKAVESAAGQAGAEVNDQANGTAYDEDLIMEDSGSEVFSFY
DPWSKALIKNPMRNKMCGHIYDRDSVMPIIMDRIGIRCPVLGCANLCYIQ
PDHLVQDANVQQKIQQSMSNAIVDVTASEEDEE*

MIP22128.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22252-PA 248 GF22252-PA 1..224 1..219 441 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\cerv-PA 241 GG19392-PA 1..231 1..228 820 65.4 Plus
Dere\GG11876-PA 240 GG11876-PA 1..230 1..228 795 65.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22621-PA 226 GH22621-PA 1..214 1..219 361 33.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
qjt-PB 233 CG13732-PB 1..233 1..233 1197 100 Plus
qjt-PA 233 CG13732-PA 1..233 1..233 1197 100 Plus
cerv-PD 230 CG15645-PD 1..226 1..233 805 69.1 Plus
cerv-PA 230 CG15645-PA 1..226 1..233 805 69.1 Plus
cerv-PC 177 CG15645-PC 1..173 58..233 645 72.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15639-PA 226 GI15639-PA 1..222 1..224 301 29.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25912-PA 232 GL25912-PA 1..223 1..226 475 42.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25188-PA 232 GA25188-PA 1..216 1..219 451 41.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\qjt-PA 233 GM25704-PA 1..233 1..233 1009 81.5 Plus
Dsec\GM22549-PA 232 GM22549-PA 1..218 1..222 828 70.7 Plus
Dsec\GM22550-PA 200 GM22550-PA 13..186 49..222 674 72.4 Plus
Dsec\GM22546-PA 98 GM22546-PA 1..84 139..222 368 77.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\qjt-PA 233 GD14711-PA 1..233 1..233 1019 82 Plus
Dsim\cerv-PA 232 GD15792-PA 1..229 1..233 837 68.2 Plus
Dsim\GD15796-PA 196 GD15796-PA 1..121 1..125 338 55.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19226-PA 225 GJ19226-PA 1..208 1..215 325 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19230-PA 226 GK19230-PA 13..214 13..219 407 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\cerv-PA 238 GE16038-PA 1..236 1..233 868 69.5 Plus
Dyak\GE26335-PA 238 GE26335-PA 1..236 1..233 851 68.2 Plus

MIP22128.hyp Sequence

Translation from 210 to 911

> MIP22128.hyp
MEFNYLADSALSTLVENKKFFKEMSDFVSDFSDGGKIKKLLEQSVEQSVE
HAVNVVHMKIKHQSLNKAMNQVKNSSATIEEFEEVWKERSKAVEQKRINV
KNLHEFKNFVKAVESAAGQAGAEVNDQANGTAYDEDLIMEDSGSEVFSFY
DPWSKALIKNPMRNKMCGHIYDRDSVMPIIMDRIGIRCPVLGCANLCYIQ
PDHLVQDANVQQKIQQSMSNAIVDVTASEEDEE*

MIP22128.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
qjt-PB 233 CG13732-PB 1..233 1..233 1197 100 Plus
qjt-PA 233 CG13732-PA 1..233 1..233 1197 100 Plus
cerv-PD 230 CG15645-PD 1..226 1..233 805 69.1 Plus
cerv-PA 230 CG15645-PA 1..226 1..233 805 69.1 Plus
cerv-PC 177 CG15645-PC 1..173 58..233 645 72.7 Plus