Clone MIP22376 Report

Search the DGRC for MIP22376

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:223
Well:76
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42710-RA
Protein status:MIP22376.pep: gold
Sequenced Size:721

Clone Sequence Records

MIP22376.complete Sequence

721 bp assembled on 2010-06-01

GenBank Submission: BT124931.1

> MIP22376.complete
CATCTATTTACATCTATTTTGAGTACAAATATAGAACAAAAAAATCTGTA
TTTGAGGAATCCAAAATTGTTAGTGCGAATCGAATTGAGCTAAGATAATG
GAAGAACTTGTAGATCTGGATGAACCTTATCTGTATATGATTGGCATACC
GACTGAACTTCGCGTGCACTGGGCCTACATAGTTGATTTTCTACGCCCAG
AAGAGAATCGTCAACAAATCAACGACCCAAATGTGGAATTAGTGCCCCTC
TCACAACGGCAATACCGAGAAGAGACTACGGACTTGGAAGTGGTGCCCTT
ACCACAAGAGCCGAGCATTGACCTATCTGGTGCTGGCGATGGACACCACG
TCATTCCCCGGATCGGTGATAACGAAATGCCGACTGTGATTATCTTTCTG
CCCAGAATAATGCCATTACCCTGGTCCAGTTTAAAGCGTCTGAAGCCGGT
GATCATTGCGGCCTCAAATATTCTCTTCAGAAAGATACTGTCCCATTTTG
GAATCGATTTAAATCAAGTCTTTGCCCTCGGCTTGTCATACAATACCCAT
TTAACAATATTTCACTGCTTTATGGAATACCTTACATCCTGGATAACTGG
GTAACATAATTTTTCAGTACCCAAATTAGCTTATAATGTTTCGAATTATA
CTGTTGTAAAGTGTGCATTCAAATAAAAATGACATAATTTTTATTTTTAA
TCAAAAAAAAAAAAAAAAAAA

MIP22376.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:38:47 has no hits.
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8780680..8781381 702..1 3510 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42710-RA 507 CG42710-PA 1..507 98..604 2535 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42710-RA 702 CG42710-RA 1..702 1..702 3510 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42710-PA 168 CG42710-PA 1..168 98..601 888 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8781789..8782500 712..1 3545 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8781789..8782500 712..1 3545 99.8 Minus
Blast to na_te.dros performed 2014-11-27 10:33:51
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6914..6946 701..669 120 84.8 Minus

MIP22376.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:45:42 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8780680..8781381 1..702 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:59:11 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
CG42710-RA 1..507 98..604 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:44:40 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
CG42710-RA 1..507 98..604 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:45:42 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
CG42710-RA 1..507 98..604 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:59:10 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
CG42710-RA 1..598 7..604 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:44:40 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
CG42710-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:45:42 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
CG42710-RA 1..702 1..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:45:42 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8781799..8782500 1..702 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:44:40 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8781799..8782500 1..702 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:36:25 Download gff for MIP22376.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8781799..8782500 1..702 100   Minus

MIP22376.pep Sequence

Translation from 97 to 603

> MIP22376.pep
MEELVDLDEPYLYMIGIPTELRVHWAYIVDFLRPEENRQQINDPNVELVP
LSQRQYREETTDLEVVPLPQEPSIDLSGAGDGHHVIPRIGDNEMPTVIIF
LPRIMPLPWSSLKRLKPVIIAASNILFRKILSHFGIDLNQVFALGLSYNT
HLTIFHCFMEYLTSWITG*

MIP22376.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14350-PA 164 GF14350-PA 1..159 1..167 315 43 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42710-PA 168 CG42710-PA 1..168 1..168 888 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24527-PA 145 GK24527-PA 60..145 76..157 155 41.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10742-PA 164 GE10742-PA 1..164 1..164 613 72 Plus

MIP22376.hyp Sequence

Translation from 97 to 603

> MIP22376.hyp
MEELVDLDEPYLYMIGIPTELRVHWAYIVDFLRPEENRQQINDPNVELVP
LSQRQYREETTDLEVVPLPQEPSIDLSGAGDGHHVIPRIGDNEMPTVIIF
LPRIMPLPWSSLKRLKPVIIAASNILFRKILSHFGIDLNQVFALGLSYNT
HLTIFHCFMEYLTSWITG*

MIP22376.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42710-PA 168 CG42710-PA 1..168 1..168 888 100 Plus