Clone MIP24784 Report

Search the DGRC for MIP24784

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:247
Well:84
Vector:pOT2
Associated Gene/TranscriptCG6901-RA
Protein status:MIP24784.pep: gold
Sequenced Size:1598

Clone Sequence Records

MIP24784.complete Sequence

1598 bp assembled on 2010-08-24

GenBank Submission: BT125619.1

> MIP24784.complete
CGAACGAGCTACCGAACGAAAAATATCGATTTTGTAAGAATGAGTGGTAT
GCAAACCACAACTGTGGACCCAGTACCCAGCCCCCCACAGGAAACCATCA
TCATCGCCACCGCGCCACCACCTGAGCCCAGAAAACCGGCTGTGACCACT
AATAACCGAGGATACTTTACCCGCATCAATAAACAGAATTATGCGTCCTA
TACAGTTTTCTTCCTATTCATCTATGGTGGCATGGACATGGCAGCCAGCT
TGGGCTGGAGTCAACCCTACAGCGTCCTCCTATTCACGGAGTACTCGTAC
TGTTGGTTTGTAGGTGTCATCATTGGAGCGCTGGCCACCACTCTCACCAT
GTCTTTTCTGCCCAAGCTGGTCTACTATGTTTTTGGTGCTCTTATGCAAC
TAACTGGATCCATTATATTTACGGCTGCAGACTATTCCGCCTGCCTGGCG
GCCCGCTATTTGGCCGGGTTAGGGATTGGCCTCATTACGGTGCCATTCCT
CATTCACAATGCTGAGGTGGCATCTAACAACTTACGAGGAGTCAACGGCG
GAATGGAGCAGTGCGGTCTAGCCCTCGGAATTTTCTTTCAAGTGATTTTT
ACTACGGAGTGGACTTCATTAATTGACTCAAACCCAAACGAGATCCATGG
CATCATAGGGATCGTCGTCTCATTGTTTGGTTTGGCGATGACTGCCCTGG
TGGTAGAGTCGCCAATCTTCTTTCTACGTCGAAATATGGAGAACAGGGCG
CAGCAGAGTCAGGAGAAACTTTTGAGACATAATCCCGGTGGCGTTAGTGC
AGCTCTGAAGGAGGCCAGAAGGTATGTGGCGGAGAGCGACAACCGGACCC
TGGGGGAGGAACTGGTGGCCTCGGTGATGCCCTTCTTGAAAATGCTACTC
TTTCGCTGCTTCGTGGCATTCTCCTTCTCTCTGCCGCTGACCATGTCGAT
CATCTCGAGCACCGCAGTAGCGGAGAAAGGACTCAGTCTTTGGCCAATCT
ACCTATTTGGCGTTCTTCGTGTGATTGGAGTAATGGTGGCTTTGATATTC
CTGGACACTTTGGGTCGCAAGGCGGTGTCCTTGGTGGGCCTCCTTGTTAT
GGCCGGACTAATGCTCGGATTGGCGGGTCTATATGCCAACGTGACCAACT
TAATTAGCTTTAACTTAATGACCTCAGCCTGCAATATCGCATTGGCCTTC
CAGGTATTCGCAGGTCTCTTCGTGTGCAGCTCATCCGCATACATGGGCGA
GGCTTTTCCCATGCGGGTCAAGTCGTTCCTGGTCGGAGTGATTGTCATCA
TTGAGCAGATCGTCCATATCGTGGTAATTGCCTGTGTAAGCTCTGTGCCC
AACAAGGACTTCTTCTTCCAGTATTTTTTGGCCGTAGGCATTATAATGCT
GGTGGGCATGATCTTCTTTACCGTGTCTATGCCGGAGACAAAGAAGATGA
CGCTGAGGAAGGCTGGCCACCGTTTTCAGAAGTGGTACGACGTACAGATG
TACTAGGTCTAAGACTCCAGACTAATATTTGTTATTTACTCTCTTACTAA
TTTAAGTTAATAAAATAAGATTCGTAAACATAAAAAAAAAAAAAAAAA

MIP24784.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12148615..12149823 379..1581 5875 99.3 Plus
chr3R 27901430 chr3R 12148104..12148308 1..205 1025 100 Plus
chr3R 27901430 chr3R 12148366..12148543 203..380 890 100 Plus
chr3R 27901430 chr3R 12151603..12151672 1193..1262 215 87.1 Plus
chr3R 27901430 chr3R 12153961..12154031 1193..1263 190 84.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-RA 1458 CG6901-PA 1..1458 49..1506 7290 100 Plus
CG17929-RB 1476 CG17929-PB 1166..1235 1193..1262 215 87.1 Plus
CG17930-RA 1509 CG17930-PA 1202..1272 1193..1263 190 84.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-RA 1581 CG6901-RA 1..1581 1..1581 7905 100 Plus
CG17929-RB 1670 CG17929-RB 1247..1316 1193..1262 215 87.1 Plus
CG17930-RA 1653 CG17930-RA 1296..1366 1193..1263 190 84.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-PA 485 CG6901-PA 1..485 49..1503 2175 100 Plus
CG17929-PB 491 CG17929-PB 29..491 130..1503 1076 52.4 Plus
CG17930-PA 502 CG17930-PA 50..502 145..1503 978 47 Plus
CG42826-PA 473 CG42826-PA 13..470 139..1491 414 28.5 Plus
CG32053-PA 496 CG32053-PA 65..491 214..1485 376 30.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16323926..16325129 379..1582 6020 100 Plus
3R 32079331 3R 16323415..16323619 1..205 1025 100 Plus
3R 32079331 3R 16323677..16323854 203..380 890 100 Plus
3R 32079331 3R 16326908..16326977 1193..1262 215 87.1 Plus
3R 32079331 3R 16329265..16329335 1193..1263 190 84.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16064757..16065960 379..1582 6020 100 Plus
3R 31820162 3R 16064246..16064450 1..205 1025 100 Plus
3R 31820162 3R 16064508..16064685 203..380 890 100 Plus
3R 31820162 3R 16067739..16067808 1193..1262 215 87.1 Plus
3R 31820162 3R 16070096..16070166 1193..1263 190 84.5 Plus
Blast to na_te.dros performed on 2014-11-27 14:05:16 has no hits.

MIP24784.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:32:12 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12148615..12149823 379..1581 99   Plus
chr3R 12148369..12148541 206..378 100 -> Plus
chr3R 12148104..12148308 1..205 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-24 12:53:51 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1458 49..1506 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:25 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1458 49..1506 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:03 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1458 49..1506 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:12 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1458 49..1506 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-24 12:53:50 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1458 49..1506 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:25 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1458 49..1506 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:03 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1581 1..1581 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:12 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
CG6901-RA 1..1581 1..1581 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:32:12 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16323926..16325128 379..1581 100   Plus
3R 16323680..16323852 206..378 100 -> Plus
3R 16323415..16323619 1..205 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:03 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12149648..12150850 379..1581 100   Plus
arm_3R 12149402..12149574 206..378 100 -> Plus
arm_3R 12149137..12149341 1..205 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:42 Download gff for MIP24784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16064757..16065959 379..1581 100   Plus
3R 16064511..16064683 206..378 100 -> Plus
3R 16064246..16064450 1..205 100 -> Plus

MIP24784.pep Sequence

Translation from 0 to 1505

> MIP24784.pep
RTSYRTKNIDFVRMSGMQTTTVDPVPSPPQETIIIATAPPPEPRKPAVTT
NNRGYFTRINKQNYASYTVFFLFIYGGMDMAASLGWSQPYSVLLFTEYSY
CWFVGVIIGALATTLTMSFLPKLVYYVFGALMQLTGSIIFTAADYSACLA
ARYLAGLGIGLITVPFLIHNAEVASNNLRGVNGGMEQCGLALGIFFQVIF
TTEWTSLIDSNPNEIHGIIGIVVSLFGLAMTALVVESPIFFLRRNMENRA
QQSQEKLLRHNPGGVSAALKEARRYVAESDNRTLGEELVASVMPFLKMLL
FRCFVAFSFSLPLTMSIISSTAVAEKGLSLWPIYLFGVLRVIGVMVALIF
LDTLGRKAVSLVGLLVMAGLMLGLAGLYANVTNLISFNLMTSACNIALAF
QVFAGLFVCSSSAYMGEAFPMRVKSFLVGVIVIIEQIVHIVVIACVSSVP
NKDFFFQYFLAVGIIMLVGMIFFTVSMPETKKMTLRKAGHRFQKWYDVQM
Y*

MIP24784.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18489-PA 486 GF18489-PA 1..479 14..494 1326 57.1 Plus
Dana\GF18490-PA 434 GF18490-PA 1..434 59..501 1114 49.2 Plus
Dana\GF18491-PA 500 GF18491-PA 1..500 17..501 1103 48.3 Plus
Dana\GF23845-PA 553 GF23845-PA 102..545 51..492 439 29.8 Plus
Dana\GF23843-PA 473 GF23843-PA 22..470 56..497 397 27.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16995-PA 490 GG16995-PA 1..490 14..501 2257 87.1 Plus
Dere\GG16996-PA 491 GG16996-PA 7..491 19..501 1232 50.8 Plus
Dere\GG16997-PA 504 GG16997-PA 1..504 17..501 1163 46.1 Plus
Dere\GG13988-PA 571 GG13988-PA 111..565 48..494 459 29.9 Plus
Dere\GG13984-PA 473 GG13984-PA 8..470 39..497 427 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19544-PA 444 GH19544-PA 1..441 60..498 1032 45.8 Plus
Dgri\GH19545-PA 498 GH19545-PA 28..498 23..501 1007 44.7 Plus
Dgri\GH19546-PA 492 GH19546-PA 25..492 28..501 1002 44.2 Plus
Dgri\GH16562-PA 534 GH16562-PA 76..526 43..493 457 28.8 Plus
Dgri\GH16560-PA 479 GH16560-PA 15..476 42..497 443 29.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-PA 485 CG6901-PA 1..485 17..501 2461 100 Plus
CG17929-PB 491 CG17929-PB 7..491 21..501 1197 51.1 Plus
CG17930-PA 502 CG17930-PA 1..502 17..501 1163 46.6 Plus
CG42826-PA 473 CG42826-PA 8..470 39..497 501 28.8 Plus
CG32054-PA 563 CG32054-PA 91..558 29..495 466 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22946-PA 496 GI22946-PA 15..496 18..501 1078 46.5 Plus
Dmoj\GI22944-PA 492 GI22944-PA 1..492 17..501 1058 45.3 Plus
Dmoj\GI22943-PA 488 GI22943-PA 29..471 59..498 1021 47.9 Plus
Dmoj\GI13854-PA 489 GI13854-PA 2..488 5..495 390 28 Plus
Dmoj\GI13851-PA 512 GI13851-PA 81..509 72..497 381 28.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21598-PA 493 GL21598-PA 1..493 17..501 1334 53 Plus
Dper\GL21599-PA 497 GL21599-PA 66..497 73..501 1067 48.2 Plus
Dper\GL11795-PA 472 GL11795-PA 1..469 35..497 428 28.2 Plus
Dper\GL11806-PA 537 GL11806-PA 78..529 46..492 382 30.4 Plus
Dper\GL11817-PA 490 GL11817-PA 6..484 26..494 343 25.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26344-PA 499 GA26344-PA 52..499 55..501 1320 55.4 Plus
Dpse\GA14732-PA 497 GA14732-PA 66..497 73..501 1111 48.4 Plus
Dpse\GA23810-PA 472 GA23810-PA 1..469 35..497 424 28.2 Plus
Dpse\GA23811-PA 561 GA23811-PA 102..553 46..492 377 30.2 Plus
Dpse\GA16641-PA 490 GA16641-PA 6..484 26..494 343 25.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15147-PA 490 GM15147-PA 3..490 17..501 2413 94.1 Plus
Dsec\GM15148-PA 491 GM15148-PA 7..491 21..501 1187 49.5 Plus
Dsec\GM15149-PA 502 GM15149-PA 1..502 17..501 1151 45.9 Plus
Dsec\GM24822-PA 553 GM24822-PA 83..547 38..494 450 29.2 Plus
Dsec\GM24821-PA 916 GM24821-PA 464..913 54..497 443 28.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19089-PA 491 GD19089-PA 1..491 14..501 2451 95.3 Plus
Dsim\GD19090-PA 491 GD19090-PA 7..491 21..501 1195 49.8 Plus
Dsim\GD19091-PA 500 GD19091-PA 1..500 17..501 1146 45.9 Plus
Dsim\GD12875-PA 496 GD12875-PA 51..490 58..494 410 31.3 Plus
Dsim\GD12874-PA 562 GD12874-PA 96..556 40..494 408 28.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23723-PA 473 GJ23723-PA 6..470 39..498 1011 46.9 Plus
Dvir\GJ23724-PA 493 GJ23724-PA 1..493 17..501 1011 44.4 Plus
Dvir\GJ11716-PA 562 GJ11716-PA 95..554 41..493 469 28.6 Plus
Dvir\GJ11717-PA 544 GJ11717-PA 118..542 72..494 409 31 Plus
Dvir\GJ11715-PA 485 GJ11715-PA 54..482 72..497 396 27.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21730-PA 532 GK21730-PA 99..532 72..501 1010 47.4 Plus
Dwil\GK13773-PA 495 GK13773-PA 68..495 70..501 922 46.4 Plus
Dwil\GK13774-PA 798 GK13774-PA 20..357 25..346 517 36.4 Plus
Dwil\GK24094-PA 484 GK24094-PA 23..481 42..497 451 28 Plus
Dwil\GK24096-PA 536 GK24096-PA 91..529 54..493 433 29.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24387-PA 490 GE24387-PA 1..490 14..501 2311 89 Plus
Dyak\GE24389-PA 491 GE24389-PA 7..491 21..501 1209 50.7 Plus
Dyak\GE24390-PA 501 GE24390-PA 1..501 17..501 1144 45.5 Plus
Dyak\GE20284-PA 573 GE20284-PA 113..567 48..494 420 28.8 Plus
Dyak\GE20283-PA 925 GE20283-PA 469..922 42..497 407 29.3 Plus

MIP24784.hyp Sequence

Translation from 0 to 1505

> MIP24784.hyp
RTSYRTKNIDFVRMSGMQTTTVDPVPSPPQETIIIATAPPPEPRKPAVTT
NNRGYFTRINKQNYASYTVFFLFIYGGMDMAASLGWSQPYSVLLFTEYSY
CWFVGVIIGALATTLTMSFLPKLVYYVFGALMQLTGSIIFTAADYSACLA
ARYLAGLGIGLITVPFLIHNAEVASNNLRGVNGGMEQCGLALGIFFQVIF
TTEWTSLIDSNPNEIHGIIGIVVSLFGLAMTALVVESPIFFLRRNMENRA
QQSQEKLLRHNPGGVSAALKEARRYVAESDNRTLGEELVASVMPFLKMLL
FRCFVAFSFSLPLTMSIISSTAVAEKGLSLWPIYLFGVLRVIGVMVALIF
LDTLGRKAVSLVGLLVMAGLMLGLAGLYANVTNLISFNLMTSACNIALAF
QVFAGLFVCSSSAYMGEAFPMRVKSFLVGVIVIIEQIVHIVVIACVSSVP
NKDFFFQYFLAVGIIMLVGMIFFTVSMPETKKMTLRKAGHRFQKWYDVQM
Y*

MIP24784.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG6901-PA 485 CG6901-PA 1..485 17..501 2461 100 Plus
CG17929-PB 491 CG17929-PB 7..491 21..501 1197 51.1 Plus
CG17930-PA 502 CG17930-PA 1..502 17..501 1163 46.6 Plus
CG42826-PA 473 CG42826-PA 8..470 39..497 501 28.8 Plus
CG32054-PA 563 CG32054-PA 91..558 29..495 466 29.4 Plus