Clone MIP24831 Report

Search the DGRC for MIP24831

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:248
Well:31
Vector:pOT2
Associated Gene/TranscriptCG3117-RB
Protein status:MIP24831.pep: gold
Sequenced Size:1234

Clone Sequence Records

MIP24831.complete Sequence

1234 bp assembled on 2010-08-26

GenBank Submission: BT125600.1

> MIP24831.complete
TTCGATTGGGAGAAGATGTCGCGGTTGTGCACTTCTTTGGTCATCATTTT
GGGTCTCATCCTCTCGAGCGGTGGCACTCACATATGCCTGAGCTCCAATC
TGTGTGTTCCCAGGGAAAATTGTCGTGAAGAGATGCCGTTCTTCGACTTT
AGTTCCACCATTGAGTGCTCCGACGAAGAAGTGTGCTGTGAAAAGTCAAA
TGTGATAGGCATGAGTAAGAGTCCTCCACAACATTCAGTGGACACACTTC
TTAGGACAAGTTATCCAAATGCCCTGGATGGAAGCCCTCAGGTGTTTGGT
GACCAAACCAAACCGAATCAATTTCCCTGGGTGACGGCTTTGTTCGCCAA
GGGATCTTATCTGGGAGGAGGATCTCTGATTACCCCAGGACTTGTACTAA
CCGCTGCCCACATCCTAGCGGGATTATCCCCCAATGACATCATGGTTAGA
GCTGGCGAATGGGATCTATCCTCCAGTGAGAAACTAAATCCACCGATGGA
TCGTCAAGTGATCAAGATCATGGAGCATGAGGCCTTTAACTACAGCAGCG
GAGCCAACGACTTGGCGCTTCTCTTCTTGGATTCGCCTTTTGAGTTGAGG
GCCAACATCCAGACCATTCGCTTACCCATTCCGGACAAGACTTTCGATCG
AAGGATATGCACGGTCGCAGGTTGGGGAATGAGATCGTCGACCGATGTTG
ATATTCAGACCATCCAGCAGAAGGTCGATTTGCCCGTTGTCGAAAGTTCC
AAATGCCAGAGGCAGCTCAGACTAACTAAAATGGGCTCGAACTACCAGCT
GCCCGCCAGTTTAATGTGTGCCGGCGGTGAGGAGGGACGGGATGTCTGTT
CTCTATTCGGAGGATTCGCCCTTTTCTGCTCCCTGGACGATGATCCCAAT
CGCTACGAGCAGGCGGGCATCGTAAGCTTCGGCGTTGGATGCGGCCAGGC
AAACGTTCCGACCACCTTCACCCATGTGTCCAAGTTCATGGAGTGGATCA
ATCCGCACTTGGAGCAAGTGCTTAGCGTGCCTGGAAATATGCTTCCTGCC
ATGTCATAATATCCTTGCACTAATGTTATCTATAAGCAAGAAAACTATAC
ATTTATCCGCATCTTAAAAGTTGGTTTATCCCAAAGAATTTGCTTATGTG
CAAGAAATACAGCCGCATCAATGGTCACATTTGTACTTTTAAGTATAATA
TAAAATATAAAAAATTTAAAAAAAAAAAAAAAAA

MIP24831.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2845611..2846624 1217..204 5070 100 Minus
chr2L 23010047 chr2L 2846689..2846897 209..1 1030 99.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-RB 1044 CG3117-PB 1..1044 16..1059 5220 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-RB 1217 CG3117-RB 1..1217 1..1217 6085 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-PB 347 CG3117-PB 1..347 16..1056 1753 100 Plus
CG14990-PA 322 CG14990-PA 51..303 259..1017 659 47.8 Plus
SPH93-PA 494 CG6639-PA 250..486 301..1011 606 49.2 Plus
CG18478-PA 294 CG18478-PA 36..293 265..1038 591 45.3 Plus
CG31827-PA 294 CG31827-PA 36..293 265..1038 591 45.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2845925..2846939 1218..204 5075 100 Minus
2L 23513712 2L 2847004..2847212 209..1 1030 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2845925..2846939 1218..204 5075 100 Minus
2L 23513712 2L 2847004..2847212 209..1 1030 99.5 Minus
Blast to na_te.dros performed on 2014-11-26 22:15:15 has no hits.

MIP24831.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 00:48:06 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2846694..2846897 1..204 100   Minus
chr2L 2845636..2846623 205..1192 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-26 14:08:54 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1044 16..1059 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:45 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1044 16..1059 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:42:35 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1044 16..1059 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:48:06 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1044 16..1059 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-26 14:08:53 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1044 16..1059 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:45 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1044 16..1059 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:42:35 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1217 1..1217 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:48:06 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
CG3117-RB 1..1217 1..1217 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 00:48:06 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2847009..2847212 1..204 100   Minus
2L 2845926..2846938 205..1217 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:42:35 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2847009..2847212 1..204 100   Minus
arm_2L 2845926..2846938 205..1217 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:44:05 Download gff for MIP24831.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2847009..2847212 1..204 100   Minus
2L 2845926..2846938 205..1217 100 <- Minus

MIP24831.pep Sequence

Translation from 0 to 1058

> MIP24831.pep
FDWEKMSRLCTSLVIILGLILSSGGTHICLSSNLCVPRENCREEMPFFDF
SSTIECSDEEVCCEKSNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFG
DQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVR
AGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELR
ANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESS
KCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPN
RYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQVLSVPGNMLPA
MS*

MIP24831.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13091-PA 347 GF13091-PA 1..344 6..347 585 35.9 Plus
Dana\GF12376-PA 457 GF12376-PA 131..451 27..339 496 34.3 Plus
Dana\GF14116-PA 400 GF14116-PA 158..372 107..316 471 43.3 Plus
Dana\GF19829-PA 216 GF19829-PA 3..201 146..344 451 42.7 Plus
Dana\GF11134-PA 345 GF11134-PA 55..339 47..334 438 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24481-PA 341 GG24481-PA 27..336 34..349 557 36.9 Plus
Dere\GG23951-PA 413 GG23951-PA 166..402 107..338 507 41.8 Plus
Dere\GG23377-PA 447 GG23377-PA 113..436 35..340 498 35.8 Plus
Dere\GG25170-PA 442 GG25170-PA 12..348 12..340 483 33.1 Plus
Dere\GG10625-PA 437 GG10625-PA 104..428 35..338 446 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13850-PA 400 GH13850-PA 104..388 60..337 511 37.8 Plus
Dgri\GH20539-PA 450 GH20539-PA 112..437 29..333 481 34.7 Plus
Dgri\GH10384-PA 371 GH10384-PA 115..359 102..344 474 39 Plus
Dgri\GH11351-PA 299 GH11351-PA 7..293 56..344 449 35.9 Plus
Dgri\GH21359-PA 458 GH21359-PA 211..444 107..334 439 36.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-PB 347 CG3117-PB 1..347 6..352 1829 100 Plus
CG14990-PA 322 CG14990-PA 51..303 87..339 659 47.8 Plus
SPH93-PA 494 CG6639-PA 250..486 101..337 606 49.2 Plus
CG18478-PA 294 CG18478-PA 36..293 89..346 591 45.3 Plus
CG31827-PA 294 CG31827-PA 36..293 89..346 591 45.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19467-PA 398 GI19467-PA 66..386 29..337 546 38.2 Plus
Dmoj\GI18807-PA 438 GI18807-PA 99..431 29..340 499 33.3 Plus
Dmoj\GI20774-PA 454 GI20774-PA 207..446 107..340 442 36.2 Plus
Dmoj\GI24370-PA 420 GI24370-PA 81..408 29..337 403 31.9 Plus
Dmoj\GI23068-PA 387 GI23068-PA 156..386 108..338 391 38.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26716-PA 298 GL26716-PA 9..291 56..338 676 45.5 Plus
Dper\GL15455-PA 294 GL15455-PA 9..290 56..337 673 45.6 Plus
Dper\GL26286-PA 294 GL26286-PA 9..290 56..337 661 44.9 Plus
Dper\GL15454-PA 525 GL15454-PA 1..360 6..350 571 37.7 Plus
Dper\GL26715-PA 220 GL26715-PA 2..205 135..339 548 48.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29037-PA 335 GA29037-PA 1..331 6..337 692 41.8 Plus
Dpse\GA29220-PA 290 GA29220-PA 9..290 56..337 673 45.6 Plus
Dpse\GA29036-PA 484 GA29036-PA 1..356 6..346 574 37.5 Plus
Dpse\GA21292-PA 462 GA21292-PA 122..454 29..340 533 35.7 Plus
Dpse\GA21182-PA 465 GA21182-PA 115..456 18..338 486 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18188-PA 346 GM18188-PA 1..346 6..352 1527 84.1 Plus
Dsec\GM17127-PA 447 GM17127-PA 200..437 101..341 635 50.8 Plus
Dsec\GM11791-PA 405 GM11791-PA 158..394 107..338 510 41.4 Plus
Dsec\GM21057-PA 459 GM21057-PA 119..448 29..337 491 34.2 Plus
Dsec\GM16118-PA 457 GM16118-PA 11..338 11..333 484 33.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22795-PA 346 GD22795-PA 1..346 6..352 1554 85.3 Plus
Dsim\GD10182-PA 326 GD10182-PA 6..309 12..338 672 40.9 Plus
Dsim\GD13811-PA 323 GD13811-PA 51..303 87..339 657 48.2 Plus
Dsim\GD21869-PA 544 GD21869-PA 295..532 101..341 635 51.2 Plus
Dsim\GD21938-PA 362 GD21938-PA 26..338 31..339 587 39.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21928-PA 395 GJ21928-PA 148..383 107..337 513 41.9 Plus
Dvir\GJ18190-PA 289 GJ18190-PA 38..284 101..339 499 40.5 Plus
Dvir\GJ18191-PA 478 GJ18191-PA 115..462 9..352 492 32.2 Plus
Dvir\GJ21834-PA 442 GJ21834-PA 107..439 29..340 477 33 Plus
Dvir\GJ20509-PA 449 GJ20509-PA 203..436 107..334 448 38.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24265-PA 294 GK24265-PA 31..282 90..337 512 41.3 Plus
Dwil\GK21734-PA 470 GK21734-PA 122..470 29..344 501 34.9 Plus
Dwil\GK21569-PA 454 GK21569-PA 121..445 35..338 451 31.4 Plus
Dwil\GK19365-PA 210 GK19365-PA 1..198 142..337 402 40.9 Plus
Dwil\GK11266-PA 405 GK11266-PA 131..405 51..339 398 33.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14996-PA 337 GE14996-PA 8..335 12..343 1280 72.3 Plus
Dyak\GE21411-PA 305 GE21411-PA 44..294 87..337 675 49 Plus
Dyak\GE13135-PA 485 GE13135-PA 218..473 78..333 671 49.4 Plus
Dyak\GE13134-PA 340 GE13134-PA 71..336 73..337 580 44 Plus
Dyak\GE19385-PA 366 GE19385-PA 1..342 6..339 562 37.9 Plus

MIP24831.hyp Sequence

Translation from 0 to 1058

> MIP24831.hyp
FDWEKMSRLCTSLVIILGLILSSGGTHICLSSNLCVPRENCREEMPFFDF
SSTIECSDEEVCCEKSNVIGMSKSPPQHSVDTLLRTSYPNALDGSPQVFG
DQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVR
AGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELR
ANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESS
KCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPN
RYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWINPHLEQVLSVPGNMLPA
MS*

MIP24831.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3117-PB 347 CG3117-PB 1..347 6..352 1829 100 Plus
CG14990-PA 322 CG14990-PA 51..303 87..339 659 47.8 Plus
SPH93-PA 494 CG6639-PA 250..486 101..337 606 49.2 Plus
CG18478-PA 294 CG18478-PA 36..293 89..346 591 45.3 Plus
CG31827-PA 294 CG31827-PA 36..293 89..346 591 45.3 Plus