Clone MIP24917 Report

Search the DGRC for MIP24917

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:249
Well:17
Vector:pOT2
Associated Gene/TranscriptCG34462-RA
Protein status:MIP24917.pep: gold
Sequenced Size:1177

Clone Sequence Records

MIP24917.complete Sequence

1177 bp assembled on 2010-08-23

GenBank Submission: BT125608.1

> MIP24917.complete
CAACTCGGCGGTCAAAAAAAAAAAAAAATAAATTAATAATAATAGCACCG
AAATAAATGTGATAGATCGATCTACAGGCGAGCAGCATTGAAATTCAGCA
TGGGACATTCGTCAAATTTGTTTTGGTTCTTTGTTTTCGTATTAATCACA
AAAGTATACGCCGCATTGTCCAATCCATTGTCATCAAAAATCGAAGTATA
CAATCAGCCTGAAGTTACACCCGAAAAAGAAAGAGCCAAAGTGAGAAACT
ATTTCGTGCATGAGCCATACGGGCCCAACACATATTCCTTTGGCTATGAG
ATTAATGATCCGCAGACGCAAAACTCTCAGTTTCGAGAAGAAAAAAGATT
TGTGAATGGCAGCATTCAAGGTAGCTACGGGTATGCAAGGCCAGATGGAC
GCATTGAAGTCACCAAATATATGGCGAAAGAGGATGGCGGTTACTCGGCC
CAGATTCAGATTTTTAAAGCAGGCGATGAGAAAGTCAAATCAGTTTGGCC
CACCGAAAGACCTGATATATTAGTGGAGAGAAGCAAATCCGATGCTCCTT
CAAATATCACCTGGGATCCAAAGAGCCATCTCAACGTGACCGTCTCTCAT
GTGGCGGATCATGTGGCCCAGCAGCTGAAGCAGCAACATGGCCTCGACCT
AAACCACATCGATGTGACCAAGGATGTGCTTAAACCAGCGGTGCTCGATG
TTATCCAGGGCAAGGAACCAACTAAGGGTCGCCCTGTTCAGAATCTAATT
CCTCAGCATTTTCCCATAGTTCCCTTCCAACTGCCGGCGGATCAAGAAAC
CACCAAGGCCACCACAGCGGAGCCCCAGAAAACTGAAAGTTCAAAATACC
ACAGGGCGCAATCCAACAATGCCGAGAAGGCTCAACAAGTCGAGGAGCCG
GAGGCAAGATTACCGCCACCCGGGCCACTGGTCAATAGCAGTCCAAGCGA
TGGAAATTGGCAACGGCGAACCATTGAGGCAAATCGCCGTGAATTCCTGG
CCAATTTACCCAACCTAAGTGAGGCCAGGCCAGAGTAAATGTTTGAAAAT
GTTTCACCAGGCCAAACTAAATGCTTAATAGTTTTTTTTACGAGAAATGC
TAAAGAGGGGTTGTTAACCAAATTGCACAGAAGAATATAAGTTAAATATA
AAACTTTATAAAAAAAAAAAAAAAAAA

MIP24917.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8321402..8322290 271..1159 4310 99 Plus
chr3L 24539361 chr3L 8321206..8321345 133..272 700 100 Plus
chr3L 24539361 chr3L 8320650..8320766 18..134 585 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-RA 939 CG34462-PA 1..939 100..1038 4695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-RA 1157 CG34462-RA 1..1157 1..1159 5730 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-PA 312 CG34462-PA 1..312 100..1035 1647 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8329349..8330243 271..1165 4475 100 Plus
3L 28110227 3L 8329160..8329299 133..272 700 100 Plus
3L 28110227 3L 8328583..8328714 1..134 605 98.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8322449..8323343 271..1165 4475 100 Plus
3L 28103327 3L 8322260..8322399 133..272 700 100 Plus
3L 28103327 3L 8321683..8321814 1..134 615 98.5 Plus
Blast to na_te.dros performed 2014-11-27 07:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 5813..5842 13..42 114 86.7 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1174..1222 64..18 114 73.5 Minus
invader3 5484 invader3 INVADER3 5484bp 5042..5085 12..55 112 72.7 Plus
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 2549..2588 13..52 110 75 Plus

MIP24917.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:09:50 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8321403..8322264 272..1133 98   Plus
chr3L 8321206..8321344 133..271 100 -> Plus
chr3L 8320678..8320764 46..132 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-23 14:15:22 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..939 100..1038 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:10 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..939 100..1038 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:38:51 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..939 100..1038 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:50 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..939 100..1038 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-23 14:15:22 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..939 100..1038 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:10 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..939 100..1038 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:38:51 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..1157 1..1159 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:50 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
CG34462-RA 1..1157 1..1159 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:09:50 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8329350..8330237 272..1159 100   Plus
3L 8329160..8329298 133..271 100 -> Plus
3L 8328583..8328712 1..132 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:38:51 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8322450..8323337 272..1159 100   Plus
arm_3L 8322260..8322398 133..271 100 -> Plus
arm_3L 8321683..8321812 1..132 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:24 Download gff for MIP24917.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8322450..8323337 272..1159 100   Plus
3L 8322260..8322398 133..271 100 -> Plus
3L 8321683..8321812 1..132 98 -> Plus

MIP24917.pep Sequence

Translation from 99 to 1037

> MIP24917.pep
MGHSSNLFWFFVFVLITKVYAALSNPLSSKIEVYNQPEVTPEKERAKVRN
YFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDG
RIEVTKYMAKEDGGYSAQIQIFKAGDEKVKSVWPTERPDILVERSKSDAP
SNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLD
VIQGKEPTKGRPVQNLIPQHFPIVPFQLPADQETTKATTAEPQKTESSKY
HRAQSNNAEKAQQVEEPEARLPPPGPLVNSSPSDGNWQRRTIEANRREFL
ANLPNLSEARPE*

MIP24917.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10287-PA 375 GF10287-PA 110..375 59..311 972 72.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14301-PA 333 GG14301-PA 80..333 59..312 1251 92.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15053-PA 291 GH15053-PA 23..289 46..309 669 48 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-PA 312 CG34462-PA 1..312 1..312 1647 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12819-PA 389 GI12819-PA 131..389 59..309 649 49.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24693-PA 272 GL24693-PA 14..270 59..309 913 67.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23955-PA 268 GA23955-PA 10..266 59..309 914 67.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25043-PA 325 GM25043-PA 1..307 1..307 1559 94.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14080-PA 307 GD14080-PA 1..307 1..312 1526 92.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12962-PA 282 GJ12962-PA 1..279 48..308 712 50.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11910-PA 389 GK11910-PA 114..379 59..307 665 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20729-PA 334 GE20729-PA 80..334 59..312 1228 90.6 Plus

MIP24917.hyp Sequence

Translation from 99 to 1037

> MIP24917.hyp
MGHSSNLFWFFVFVLITKVYAALSNPLSSKIEVYNQPEVTPEKERAKVRN
YFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDG
RIEVTKYMAKEDGGYSAQIQIFKAGDEKVKSVWPTERPDILVERSKSDAP
SNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLD
VIQGKEPTKGRPVQNLIPQHFPIVPFQLPADQETTKATTAEPQKTESSKY
HRAQSNNAEKAQQVEEPEARLPPPGPLVNSSPSDGNWQRRTIEANRREFL
ANLPNLSEARPE*

MIP24917.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34462-PA 312 CG34462-PA 1..312 1..312 1647 100 Plus