Clone MIP24925 Report

Search the DGRC for MIP24925

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:249
Well:25
Vector:pOT2
Associated Gene/TranscriptCG11581-RA
Protein status:MIP24925.pep: gold
Sequenced Size:1145

Clone Sequence Records

MIP24925.complete Sequence

1145 bp assembled on 2010-08-24

GenBank Submission: BT125620.1

> MIP24925.complete
CCAGAGATCAAACCGGAGCTCGAGATGATGCAGCCATGGGCCGTTGTGGT
CCTACTTCTGCCCCTGATCAACGGAGATGTGAGTCACCTGCCCAGGGAAT
ATATACCGCCCAGTGCGGAACTGGAGCCAACCACACGGTCTGCTGCTGAT
GGCCAGGAGGTGCAGAAGGATCCATCTGGATTCTATCCATCGACTGGACT
GCCACTGCCGCCGGGCTATGCCATTCCCACGGGCAGCAACGTTTTGCCAC
AGCCTGTCCAGCCGCCAAACTTCCCTCTGCCCATCTATCCACCATTCTAC
GGCTTCGGCGGAGGTCCTGTCGAGCAGGGAGGAGGACATGGTATTGGGCC
AGTGCCTTCGGCCTATCCCAACGGAGGTGCATTCCCGGCGGGTCCTACCA
ATGGAGGCGCATTCGCAGGGGGTCCTACGAATGCGGCCTTCCAACTGCCA
CCAGGTGGTCCTTTCGGTCCGCAAGCTGGTAATTTTGCCCAGCCAGGTGG
TTTCCCGCAGGCAGGTGGGTTTCCCCCACAAGGAGCTGGCTTCCAGCCAC
AAGGCATCCCTGGCAATGGATTCCCAACGCAAGGAGCTCCCTTCTCACCA
CAGCAGGGAGTGTTCCCATCACAAGGAGGTGCCTTCGGGCCACAGGGAAT
ACCGGGCAATGGTTTCCTAGGAGGTAACTTCCCGCCACAGGGAGGGCCCT
TCCCAGGATCCGCATATCCACCGGAGTTCTTGACAAACCAGGGACTTCCC
CTCACAAATCCCCAGGGTCCCTTCCAAGGACCCAGTCCAGCAGGATTCAA
TGTGCCCGCAGGATTCGGCGGACCTGTGCCCGGCCAGAATCCCTACCAAC
AATTTGGACCCGGTTTCGGAGGACCCGCTCCGCCGGGCTACTCCGATGAG
CCGGCGAAGGAGCAACCAAAGGACAGTGAGAGGACAGTAGTGGCACCACC
ATCGGCCGACGATCCCAAGAGTGTGGCGGATACGGTTTACGCATCCAATG
GCGGCTATGTCTACAAGAGGGCCAAGTAATGCGATGGCTTTCGAAGCCCC
AAATTGGGGAGTTCATCAAACATGTTCGCCATAAATTATGATCCATAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP24925.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14067479..14068574 1..1096 5150 98 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11581-RB 1005 CG11581-PB 1..1005 25..1029 5025 100 Plus
CG11581-RA 1005 CG11581-PA 1..1005 25..1029 5025 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG11581-RB 1534 CG11581-RB 1..1096 1..1096 5480 100 Plus
CG11581-RA 1096 CG11581-RA 1..1096 1..1096 5480 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11581-PB 334 CG11581-PB 1..334 25..1026 1021 100 Plus
CG11581-PA 334 CG11581-PA 1..334 25..1026 1021 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14176923..14178019 1..1097 5485 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14185021..14186117 1..1097 5485 100 Plus
Blast to na_te.dros performed on 2014-11-27 04:02:37 has no hits.

MIP24925.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:05:54 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14067479..14068574 1..1096 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-24 12:59:11 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1005 25..1029 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:26 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1005 25..1029 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:51 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1005 25..1029 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:54 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1005 25..1029 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-24 12:59:11 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1005 25..1029 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:26 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1005 25..1029 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:51 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1096 1..1096 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:54 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
CG11581-RA 1..1096 1..1096 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:05:54 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
X 14176923..14178018 1..1096 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:51 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14070956..14072051 1..1096 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:44 Download gff for MIP24925.complete
Subject Subject Range Query Range Percent Splice Strand
X 14185021..14186116 1..1096 100   Plus

MIP24925.pep Sequence

Translation from 0 to 1028

> MIP24925.pep
PEIKPELEMMQPWAVVVLLLPLINGDVSHLPREYIPPSAELEPTTRSAAD
GQEVQKDPSGFYPSTGLPLPPGYAIPTGSNVLPQPVQPPNFPLPIYPPFY
GFGGGPVEQGGGHGIGPVPSAYPNGGAFPAGPTNGGAFAGGPTNAAFQLP
PGGPFGPQAGNFAQPGGFPQAGGFPPQGAGFQPQGIPGNGFPTQGAPFSP
QQGVFPSQGGAFGPQGIPGNGFLGGNFPPQGGPFPGSAYPPEFLTNQGLP
LTNPQGPFQGPSPAGFNVPAGFGGPVPGQNPYQQFGPGFGGPAPPGYSDE
PAKEQPKDSERTVVAPPSADDPKSVADTVYASNGGYVYKRAK*

MIP24925.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19238-PA 324 GF19238-PA 1..324 10..342 542 55.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17826-PA 344 GG17826-PA 1..344 9..342 922 74.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17680-PA 394 GH17680-PA 24..182 24..162 171 38.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG11581-PB 334 CG11581-PB 1..334 9..342 1868 100 Plus
CG11581-PA 334 CG11581-PA 1..334 9..342 1868 100 Plus
CG15635-PB 1136 CG15635-PB 408..717 29..301 209 30.6 Plus
CG15635-PB 1136 CG15635-PB 583..900 27..337 209 28.3 Plus
CG15635-PB 1136 CG15635-PB 288..604 27..336 200 29 Plus
ZAP3-PF 1258 CG32685-PF 1022..1223 97..311 196 31.1 Plus
ZAP3-PD 1293 CG32685-PD 1022..1223 97..311 196 31.1 Plus
CG15635-PB 1136 CG15635-PB 728..1064 21..322 184 28.4 Plus
CG15635-PB 1136 CG15635-PB 819..1092 27..281 174 32.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21502-PA 343 GI21502-PA 22..343 24..342 263 39.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11079-PA 383 GA11079-PA 16..148 23..162 193 46.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17655-PA 332 GM17655-PA 1..214 9..222 842 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17155-PA 354 GD17155-PA 1..354 9..342 1299 89.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19041-PA 343 GJ19041-PA 22..343 24..342 277 41.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25849-PA 332 GK25849-PA 13..332 13..342 315 43.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17118-PA 334 GE17118-PA 1..334 9..342 1132 82.3 Plus

MIP24925.hyp Sequence

Translation from 0 to 1028

> MIP24925.hyp
PEIKPELEMMQPWAVVVLLLPLINGDVSHLPREYIPPSAELEPTTRSAAD
GQEVQKDPSGFYPSTGLPLPPGYAIPTGSNVLPQPVQPPNFPLPIYPPFY
GFGGGPVEQGGGHGIGPVPSAYPNGGAFPAGPTNGGAFAGGPTNAAFQLP
PGGPFGPQAGNFAQPGGFPQAGGFPPQGAGFQPQGIPGNGFPTQGAPFSP
QQGVFPSQGGAFGPQGIPGNGFLGGNFPPQGGPFPGSAYPPEFLTNQGLP
LTNPQGPFQGPSPAGFNVPAGFGGPVPGQNPYQQFGPGFGGPAPPGYSDE
PAKEQPKDSERTVVAPPSADDPKSVADTVYASNGGYVYKRAK*

MIP24925.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG11581-PB 334 CG11581-PB 1..334 9..342 1868 100 Plus
CG11581-PA 334 CG11581-PA 1..334 9..342 1868 100 Plus
CG15635-PB 1136 CG15635-PB 408..717 29..301 209 30.6 Plus
CG15635-PB 1136 CG15635-PB 583..900 27..337 209 28.3 Plus
CG15635-PB 1136 CG15635-PB 288..604 27..336 200 29 Plus
ZAP3-PF 1258 CG32685-PF 1022..1223 97..311 196 31.1 Plus
ZAP3-PD 1293 CG32685-PD 1022..1223 97..311 196 31.1 Plus
CG15635-PB 1136 CG15635-PB 728..1064 21..322 184 28.4 Plus
CG15635-PB 1136 CG15635-PB 819..1092 27..281 174 32.2 Plus