Clone MIP24941 Report

Search the DGRC for MIP24941

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:249
Well:41
Vector:pOT2
Associated Gene/TranscriptCG18735-RA
Protein status:MIP24941.pep: gold
Sequenced Size:1190

Clone Sequence Records

MIP24941.complete Sequence

1190 bp assembled on 2010-08-23

GenBank Submission: BT125606.1

> MIP24941.complete
CCAGTTGGCCAGGTTAGTACACCATGTGTAATTTTCATCTTCTGCTGATT
CTTGCCACAGCACTGGGCGATTTGGCTTGTGCCACGCCCTCTCTGCGTTC
CGCCTCCGATCCTGAGAAGATCTTAAACAATCTAGCTCAACTAAGGCAGA
GTAGCTTTCTGGACTGGATTCAATCGATCCTGGGACCCGAGGTGCCAGCC
GAATGGAGCTCTCCGGCCAAAAGGGAGTGCGCAGAGTGCTCCTGTGGTAA
TATCAATACTCGTCATCGCATCGTCGGAGGTCAGGAGACGGAGGTCCATG
AGTATCCCTGGATGATAATGCTCATGTGGTTCGGTAATTTCTATTGCGGC
GCTTCTTTGGTTAACGATCAGTATGCCTTAACCGCTGCCCATTGTGTAAA
TGGCTTCTACCATCGTTTGATCACGGTCCGATTGCTGGAGCATAATCGTC
AGGATAGCCACGTCAAGATCGTGGATCGCCGGGTTTCCAGGGTGCTCATC
CACCCGAAGTACAGCACCAGGAACTTTGACAGTGACATTGCTTTGATTCG
TTTCAATGAACCAGTTCGTCTTGGCATCGATATGCATCCAGTATGCATGC
CCACTCCGAGCGAAAATTATGCGGGTCAAACTGCCGTGGTCACCGGATGG
GGAGCTCTGAGTGAGGGCGGACCAATTTCTGATACCCTCCAGGAGGTGGA
AGTGCCCATCCTCAGCCAAGAAGAGTGCCGCAATAGCAACTACGGCGAGT
CCAAGATTACCGACAACATGATCTGTGCCGGCTACGTGGAGCAAGGTGGC
AAGGACTCCTGCCAAGGAGACAGCGGTGGACCCATGCATGTACTGGGTTC
CGGCGACGCTTACCAGCTGGCAGGAATCGTGTCCTGGGGCGAAGGATGTG
CCAAGCCGAATGCCCCGGGCGTTTATACACGAGTGGGCAGCTTCAATGAT
TGGATTGCGGAGAACACCAGGGATGCCTGCTCCTGTGCCCAACCAGAAGC
TGCTGGGGAACCAGCTTCCCCTATGGAAACCACCGAGCAGGGAGACCAAG
AGAACACCACTGCAAATGGAGCAGCAGAAGCAGATCCCGAGGTGGAGGAG
GCCAATAAGTTGATTTGAAATTGATTTATTTCTTCGTCAAATTTTTTGTA
TTGCAAATAAAGGCCACTCAACTAAAAAAAAAAAAAAAAA

MIP24941.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17684437..17685609 1173..1 5595 98.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-RA 1095 CG18735-PA 1..1095 24..1118 5475 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-RA 1179 CG18735-RA 7..1179 1..1173 5865 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-PA 364 CG18735-PA 1..364 24..1115 1887 100 Plus
CG4386-PA 372 CG4386-PA 53..366 87..992 893 54.1 Plus
CG9294-PB 352 CG9294-PB 82..344 213..986 739 51.7 Plus
CG4914-PA 374 CG4914-PA 83..370 129..986 654 46 Plus
CG3355-PA 314 CG3355-PA 43..312 195..986 630 47.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21798014..21799189 1176..1 5880 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21799213..21800388 1176..1 5880 100 Minus
Blast to na_te.dros performed 2014-11-26 23:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
Doc2-element 4789 Doc2-element DOC2 4789bp 1358..1444 104..16 123 65.6 Minus

MIP24941.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:22:29 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17684437..17685609 1..1173 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-23 14:04:38 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 1..1095 24..1118 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:08 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 1..1095 24..1118 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:05 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 1..1095 24..1118 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:29 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 1..1095 24..1118 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-23 14:04:38 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 1..1095 24..1118 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:08 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 1..1095 24..1118 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:05 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 7..1179 1..1173 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:29 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
CG18735-RA 7..1179 1..1173 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:22:29 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21798017..21799189 1..1173 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:05 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17685522..17686694 1..1173 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:22 Download gff for MIP24941.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21799216..21800388 1..1173 100   Minus

MIP24941.pep Sequence

Translation from 23 to 1117

> MIP24941.pep
MCNFHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQ
SILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML
MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIV
DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA
GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMI
CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGV
YTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGA
AEADPEVEEANKLI*

MIP24941.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11617-PA 354 GF11617-PA 1..354 1..364 1658 84.3 Plus
Dana\GF11616-PA 379 GF11616-PA 118..373 67..323 896 60.9 Plus
Dana\GF13273-PA 350 GF13273-PA 78..342 62..321 740 51.7 Plus
Dana\GF25188-PA 375 GF25188-PA 88..371 40..321 664 47.4 Plus
Dana\GF21354-PA 315 GF21354-PA 67..313 72..321 648 50.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20744-PA 364 GG20744-PA 1..364 1..364 1872 95.1 Plus
Dere\GG20743-PA 372 GG20743-PA 111..366 67..323 900 60.9 Plus
Dere\GG22144-PA 343 GG22144-PA 73..335 64..321 755 53.6 Plus
Dere\GG13716-PA 371 GG13716-PA 84..367 40..321 660 47.1 Plus
Dere\GG25012-PA 314 GG25012-PA 43..312 58..321 631 47.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20777-PA 356 GH20777-PA 25..354 29..362 1317 72.2 Plus
Dgri\GH20776-PA 378 GH20776-PA 107..372 57..323 880 58.2 Plus
Dgri\GH21133-PA 349 GH21133-PA 28..336 40..326 752 48.2 Plus
Dgri\GH16799-PA 368 GH16799-PA 76..366 34..323 634 44.4 Plus
Dgri\GH13131-PA 318 GH13131-PA 68..316 70..321 628 47.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-PA 364 CG18735-PA 1..364 1..364 1957 100 Plus
CG4386-PA 372 CG4386-PA 53..366 22..323 893 54.1 Plus
CG9294-PB 352 CG9294-PB 82..344 64..321 739 51.7 Plus
CG4914-PA 374 CG4914-PA 83..370 36..321 654 46 Plus
CG3355-PA 314 CG3355-PA 43..312 58..321 630 47.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20861-PA 359 GI20861-PA 1..355 4..360 1477 75.6 Plus
Dmoj\GI20860-PA 396 GI20860-PA 135..390 67..323 881 60.5 Plus
Dmoj\GI22815-PA 312 GI22815-PA 28..310 39..321 662 46.7 Plus
Dmoj\GI13812-PA 377 GI13812-PA 90..375 39..323 662 46.6 Plus
Dmoj\GI13599-PA 364 GI13599-PA 113..364 68..323 632 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17517-PA 363 GL17517-PA 6..363 7..364 1543 78.9 Plus
Dper\GL17516-PA 377 GL17516-PA 116..371 67..323 893 60.9 Plus
Dper\GL26150-PA 373 GL26150-PA 86..369 40..321 660 47.4 Plus
Dper\GL14423-PA 314 GL14423-PA 66..312 72..321 629 49 Plus
Dper\GL20989-PA 369 GL20989-PA 118..367 68..321 625 47.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15058-PA 364 GA15058-PA 15..364 15..364 1504 78.7 Plus
Dpse\GA18150-PA 375 GA18150-PA 114..369 67..323 894 60.9 Plus
Dpse\GA21676-PA 333 GA21676-PA 62..325 63..321 727 51.1 Plus
Dpse\GA18522-PA 375 GA18522-PA 88..371 40..321 660 47.4 Plus
Dpse\GA17401-PA 314 GA17401-PA 66..312 72..321 628 49 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15687-PA 364 GM15687-PA 1..364 1..364 1926 97.8 Plus
Dsec\GM15686-PA 372 GM15686-PA 111..366 67..323 891 60.5 Plus
Dsec\GM15869-PA 313 GM15869-PA 66..305 87..321 668 53.3 Plus
Dsec\GM24537-PA 374 GM24537-PA 83..370 36..321 659 46.4 Plus
Dsec\GM18483-PA 314 GM18483-PA 43..312 58..321 631 47.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25166-PA 364 GD25166-PA 1..364 1..364 1932 98.1 Plus
Dsim\GD25165-PA 372 GD25165-PA 111..366 67..323 894 60.9 Plus
Dsim\GD11631-PA 354 GD11631-PA 84..346 64..321 744 53.6 Plus
Dsim\GD12611-PA 377 GD12611-PA 81..373 26..321 655 45.9 Plus
Dsim\GD23293-PA 314 GD23293-PA 43..312 58..321 632 47.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20596-PA 354 GJ20596-PA 15..353 20..363 1452 77.3 Plus
Dvir\GJ20595-PA 373 GJ20595-PA 102..365 57..321 876 58.3 Plus
Dvir\GJ21756-PA 345 GJ21756-PA 30..339 38..323 822 51.6 Plus
Dvir\GJ23363-PA 318 GJ23363-PA 68..316 70..321 642 49 Plus
Dvir\GJ11677-PA 534 GJ11677-PA 279..530 74..321 634 49.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15653-PA 375 GK15653-PA 21..375 20..364 1437 76.6 Plus
Dwil\GK15652-PA 366 GK15652-PA 105..360 67..323 896 60.5 Plus
Dwil\GK15931-PA 357 GK15931-PA 85..349 62..321 764 53.6 Plus
Dwil\GK10588-PA 358 GK10588-PA 51..354 20..321 660 45.6 Plus
Dwil\GK23752-PA 324 GK23752-PA 76..322 72..321 615 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13676-PA 364 GE13676-PA 1..364 1..364 1842 95.9 Plus
Dyak\GE13675-PA 378 GE13675-PA 117..372 67..323 893 60.5 Plus
Dyak\GE12225-PA 359 GE12225-PA 89..351 64..321 757 54 Plus
Dyak\GE20012-PA 387 GE20012-PA 100..383 40..321 659 46.7 Plus
Dyak\GE18301-PA 314 GE18301-PA 43..312 58..321 630 47.1 Plus

MIP24941.hyp Sequence

Translation from 23 to 1117

> MIP24941.hyp
MCNFHLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQ
SILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML
MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIV
DRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA
GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMI
CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGV
YTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGA
AEADPEVEEANKLI*

MIP24941.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG18735-PA 364 CG18735-PA 1..364 1..364 1957 100 Plus
CG4386-PA 372 CG4386-PA 53..366 22..323 893 54.1 Plus
CG9294-PB 352 CG9294-PB 82..344 64..321 739 51.7 Plus
CG4914-PA 374 CG4914-PA 83..370 36..321 654 46 Plus
CG3355-PA 314 CG3355-PA 43..312 58..321 630 47.1 Plus