Clone MIP25013 Report

Search the DGRC for MIP25013

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:250
Well:13
Vector:pOT2
Associated Gene/TranscriptCG6012-RA
Protein status:MIP25013.pep: gold
Sequenced Size:1058

Clone Sequence Records

MIP25013.complete Sequence

1058 bp assembled on 2010-08-20

GenBank Submission: BT125579.1

> MIP25013.complete
TCGACCGTATAACACACACGTACTTTCCGCTGTAGCGCAGTCGATTAAAA
TTACTAAATAAATCGACAAAATGTTCTGTGCCCTATCAGCATTCCTCACA
TTCGTTGGTGTCTATGCCCTGTCCTCTTATCTCTACGAGCAGTTAAGAAC
GCCGTACAAATTAATCAAAATCAGGTATTTCAGTGGGACTAGGCCAACTC
TGAAGGAGCGTTTCGGAGATTGGGCCGCTGTCACGGGTGCCAGCGATGGA
ATTGGCAAGGAATATGCCAAGGAGCTGGCCCGCCAGAACATCAATGTGGT
CCTAATCGCTAGAACCGAGGAGAAACTCCAGGCGGTTGCCAAGGAAATCG
CGGATTGCGGTGCCGGTGTTCAGACCAAAATAGTGATAGCTGATTTTACC
AAGGGCTCGCAGGTCTATGAGCACATAGAAAAGGAAACTGCCAATATACC
CATTTCCATACTTGTAAACAACGTTGGAATCGCCACGCCGAAATCCTTGC
TGAAATATAACCAGGAAGAAACGCAAAACATCATCGACACCAACGTGGTG
GCCGTTTCCCAGCTGTCTCGCATCTTCTTCCAGCGCATGAAGGCGTCTAA
ATTGAAGGGAGCCATTGTGAATGTTGGTTCCGGCACGGAACTGCAGCCAC
TTCCCAATGGAGCCTACTATGCCGCCTCCAAGGCGTACACCCGTAGTTTA
ACCCTGGCCTTGTACCACGAGGCGAAGCCTTATGGCATCCATGTGCAGAT
GTTGTCCCCGAACTTTGTGGTTACCAAAATCAACTCGTACTCCAGGCAGA
TCATGAAGGGTGGTCTCCTAATCCCATCGGCGTCGGCTTATGCCAAGAGT
GCGGTTAATCAGCTGCGGGACGAAGTGGACGAGACTCCTGGTTACCTGTG
GCACCATGTCCAAAACGCTGTGGCCACCGCCTTCACCTGGCGAGTGCGAA
CCTATGTCGCCTGTAAATTGTTCAACAAAATATCCGACAATATATAGCTG
AAATAACATTTTAAAAACAATAAAAATACAAATCACAAGCCAAAAAAAAA
AAAAAAAA

MIP25013.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16858710..16859288 1041..464 2755 98.8 Minus
chr2L 23010047 chr2L 16859822..16860171 350..1 1750 100 Minus
chr2L 23010047 chr2L 16859355..16859469 464..350 575 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-RA 927 CG6012-PA 1..927 71..997 4635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-RA 1041 CG6012-RA 1..1041 1..1041 5205 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-PA 308 CG6012-PA 1..308 71..994 1564 100 Plus
CG31809-PC 316 CG31809-PC 7..301 104..982 612 46 Plus
CG31809-PB 316 CG31809-PB 7..301 104..982 612 46 Plus
CG13284-PE 325 CG13284-PE 8..310 83..982 612 45.4 Plus
CG13284-PA 325 CG13284-PA 8..310 83..982 612 45.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16860023..16860606 1047..464 2920 100 Minus
2L 23513712 2L 16861140..16861489 350..1 1750 100 Minus
2L 23513712 2L 16860673..16860787 464..350 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16860023..16860606 1047..464 2920 100 Minus
2L 23513712 2L 16861140..16861489 350..1 1750 100 Minus
2L 23513712 2L 16860673..16860787 464..350 575 100 Minus
Blast to na_te.dros performed on 2014-11-27 04:01:25 has no hits.

MIP25013.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:05:34 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16859822..16860171 1..350 100   Minus
chr2L 16859355..16859468 351..464 100 <- Minus
chr2L 16858710..16859287 465..1041 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:06:44 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..927 71..997 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:29 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..927 71..997 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:33 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..927 71..997 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:34 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..927 71..997 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:06:44 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..927 71..997 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:29 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..927 71..997 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:33 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..1041 1..1041 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:34 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6012-RA 1..1041 1..1041 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:05:34 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16861140..16861489 1..350 100   Minus
2L 16860673..16860786 351..464 100 <- Minus
2L 16860029..16860605 465..1041 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:33 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16861140..16861489 1..350 100   Minus
arm_2L 16860673..16860786 351..464 100 <- Minus
arm_2L 16860029..16860605 465..1041 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:38 Download gff for MIP25013.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16861140..16861489 1..350 100   Minus
2L 16860673..16860786 351..464 100 <- Minus
2L 16860029..16860605 465..1041 100 <- Minus

MIP25013.pep Sequence

Translation from 70 to 996

> MIP25013.pep
MFCALSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGD
WAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGV
QTKIVIADFTKGSQVYEHIEKETANIPISILVNNVGIATPKSLLKYNQEE
TQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYY
AASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLL
IPSASAYAKSAVNQLRDEVDETPGYLWHHVQNAVATAFTWRVRTYVACKL
FNKISDNI*

MIP25013.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14539-PA 312 GF14539-PA 1..303 5..306 1193 73.7 Plus
Dana\GF14538-PA 302 GF14538-PA 1..299 3..300 1099 73.3 Plus
Dana\GF14540-PA 341 GF14540-PA 25..326 8..304 580 42.6 Plus
Dana\GF21190-PA 318 GF21190-PA 47..276 47..278 413 40.1 Plus
Dana\GF22046-PA 251 GF22046-PA 10..187 54..238 223 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21767-PA 302 GG21767-PA 1..301 1..301 1417 87.4 Plus
Dere\GG21766-PA 342 GG21766-PA 1..340 1..306 1322 78.2 Plus
Dere\GG21768-PA 339 GG21768-PA 22..324 5..304 627 44.8 Plus
Dere\GG19668-PA 321 GG19668-PA 50..279 47..278 382 37.1 Plus
Dere\GG12728-PA 251 GG12728-PA 10..186 54..237 228 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13771-PA 311 GH13771-PA 1..307 1..306 1074 65.7 Plus
Dgri\GH13773-PA 335 GH13773-PA 28..301 11..281 589 45.8 Plus
Dgri\GH24302-PA 320 GH24302-PA 49..278 47..278 394 38 Plus
Dgri\GH22973-PA 257 GH22973-PA 2..193 42..238 173 31.3 Plus
Dgri\GH12229-PA 250 GH12229-PA 9..203 52..237 172 28.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-PA 308 CG6012-PA 1..308 1..308 1564 100 Plus
CG31809-PC 316 CG31809-PC 7..301 12..304 612 46 Plus
CG31809-PB 316 CG31809-PB 7..301 12..304 612 46 Plus
CG13284-PE 325 CG13284-PE 8..310 5..304 612 45.4 Plus
CG13284-PA 325 CG13284-PA 8..310 5..304 612 45.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17176-PA 310 GI17176-PA 1..307 1..306 1048 64.1 Plus
Dmoj\GI17177-PA 335 GI17177-PA 22..301 5..281 612 47.3 Plus
Dmoj\GI21544-PA 320 GI21544-PA 50..278 48..278 375 38.1 Plus
Dmoj\GI14997-PA 255 GI14997-PA 10..192 54..239 225 33.5 Plus
Dmoj\GI10241-PA 257 GI10241-PA 11..205 54..259 176 31.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19325-PA 305 GL19325-PA 1..304 1..304 1190 73.9 Plus
Dper\GL19326-PA 344 GL19326-PA 22..328 5..304 591 42.6 Plus
Dper\GL18340-PA 320 GL18340-PA 49..278 47..278 392 39.7 Plus
Dper\GL14417-PA 255 GL14417-PA 10..191 54..238 226 33.5 Plus
Dper\GL24511-PA 257 GL24511-PA 11..205 54..259 198 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19294-PA 305 GA19294-PA 1..304 1..304 1192 73.9 Plus
Dpse\GA12171-PA 340 GA12171-PA 18..324 1..304 627 43.5 Plus
Dpse\GA12987-PA 320 GA12987-PA 49..278 47..278 392 39.7 Plus
Dpse\GA17622-PA 255 GA17622-PA 10..191 54..238 226 33.5 Plus
Dpse\GA11451-PA 257 GA11451-PA 11..205 54..259 202 33.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17150-PA 450 GM17150-PA 1..297 1..297 1492 93.9 Plus
Dsec\GM17152-PA 339 GM17152-PA 22..324 5..304 637 45.8 Plus
Dsec\GM11981-PA 321 GM11981-PA 50..279 47..278 392 37.6 Plus
Dsec\GM17150-PA 450 GM17150-PA 298..433 12..181 236 37.1 Plus
Dsec\GM19006-PA 251 GM19006-PA 10..187 54..238 233 34.4 Plus
Dsec\GM10825-PA 257 GM10825-PA 11..193 54..238 193 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21890-PA 308 GD21890-PA 1..306 1..306 1529 93.8 Plus
Dsim\GD21891-PA 305 GD21891-PA 1..290 17..304 621 45.4 Plus
Dsim\GD16868-PA 321 GD16868-PA 50..279 47..278 392 37.6 Plus
Dsim\GD16445-PA 251 GD16445-PA 10..187 54..238 233 34.4 Plus
Dsim\GD19803-PA 257 GD19803-PA 2..205 42..259 182 30.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17420-PA 312 GJ17420-PA 1..307 1..306 1107 67.7 Plus
Dvir\GJ17421-PA 335 GJ17421-PA 28..301 11..281 582 44.4 Plus
Dvir\GJ15689-PA 320 GJ15689-PA 40..278 37..278 401 39.7 Plus
Dvir\GJ15354-PA 255 GJ15354-PA 10..192 54..239 203 32.1 Plus
Dvir\GJ10124-PA 255 GJ10124-PA 5..194 49..241 168 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18149-PA 311 GK18149-PA 1..307 1..306 1086 65.9 Plus
Dwil\GK18150-PA 300 GK18150-PA 1..295 1..294 1019 65.5 Plus
Dwil\GK11524-PA 314 GK11524-PA 10..306 11..304 591 42.3 Plus
Dwil\GK18151-PA 340 GK18151-PA 30..325 12..304 585 43.5 Plus
Dwil\GK10112-PA 320 GK10112-PA 49..278 47..278 399 38.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13156-PA 308 GE13156-PA 1..306 1..306 1491 91.2 Plus
Dyak\GE13157-PA 302 GE13157-PA 1..301 1..301 1421 87.7 Plus
Dyak\GE13158-PA 339 GE13158-PA 22..324 5..304 623 44.8 Plus
Dyak\GE15745-PA 321 GE15745-PA 50..279 47..278 391 37.6 Plus
Dyak\GE16554-PA 251 GE16554-PA 10..186 54..237 223 34.1 Plus

MIP25013.hyp Sequence

Translation from 70 to 996

> MIP25013.hyp
MFCALSAFLTFVGVYALSSYLYEQLRTPYKLIKIRYFSGTRPTLKERFGD
WAAVTGASDGIGKEYAKELARQNINVVLIARTEEKLQAVAKEIADCGAGV
QTKIVIADFTKGSQVYEHIEKETANIPISILVNNVGIATPKSLLKYNQEE
TQNIIDTNVVAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYY
AASKAYTRSLTLALYHEAKPYGIHVQMLSPNFVVTKINSYSRQIMKGGLL
IPSASAYAKSAVNQLRDEVDETPGYLWHHVQNAVATAFTWRVRTYVACKL
FNKISDNI*

MIP25013.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG6012-PA 308 CG6012-PA 1..308 1..308 1564 100 Plus
CG31809-PC 316 CG31809-PC 7..301 12..304 612 46 Plus
CG31809-PB 316 CG31809-PB 7..301 12..304 612 46 Plus
CG13284-PE 325 CG13284-PE 8..310 5..304 612 45.4 Plus
CG13284-PA 325 CG13284-PA 8..310 5..304 612 45.4 Plus