Clone MIP25022 Report

Search the DGRC for MIP25022

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:250
Well:22
Vector:pOT2
Associated Gene/TranscriptSt2-RA
Protein status:MIP25022.pep: gold
Sequenced Size:1160

Clone Sequence Records

MIP25022.complete Sequence

1160 bp assembled on 2010-08-20

GenBank Submission: BT125580.1

> MIP25022.complete
GCCAAAGCAGTTGAAAGATACAGGAGCCATGCAGCTAATTTATCGTGAAC
TCGAGGAGGACATACTTCGACGCACTAATGCAGTCTTTCCGGTACAAAAT
TGCTTTGTTGAGGTCCTCCCCGATCAGTTTATCATTCCCAGAAAGTACGT
GGAGCTGGGCGAATCGATTCGATCGCTTCCCGTTTACCAGGACGACGTAT
GGATGGTGTCCTATCCACGAACCGGATCGACGTGGGCCCAGGAGATGGTC
TGGCTGCTGGGTCACCAATTGGATTACGTGGCCGCTGAGCAAGATTTAAG
ATTGCGATCTCCGCTCATTGAACTATCCGCTTTGTTTAGCATCGATCATC
ACGAGACGGTGGCCCAAAAGTTTGGCAATACCGTGGATCTGGTTCGCAAT
CTGCCACGCCCACGTTTTGCACGCTCCCACCTGCCGTGGCCTTTGCTACC
CGAGCAATTTGAGACGGTAAAGCCGAGGATCGTGTATACTGCTCGAAATC
CCAAGGATCTTTGCGTCTCGTACTATCACTACTTCAAGTTGCTGCACGGC
ATGAATGGGGACTTTGAGCAATTCGTGGATCTCTTCCTGGAGGGGCACAC
ACCGATGGGATCCTATTGGCGGCACGTCCTGCCCTTTTGGAAACGTAGCC
AGGATGATAATGTGCTGTTCATCAAGTACGAGGACATGGTCAAGGATCTG
CCCAGTGTAGTTCGCCGCTGTGCCAGATTCCTGGGCGTTCAAAGTCTCCT
CGATGTGAGCACTTTGCAGAAATTGTGCGATCACCTCACATTCGACAAGA
TGCGGGCGAACAAGGCGGTGAATCTGGAGAAGCTGCTCCCGGAATCATCT
TCCAAGTTCATACGCAATGGCAAGATCGGGGATTGGCGCAATCACATGGG
CAATGAGATGTCGGAACGCTTTGATGAATGGACCGAGAGACATATGCGTG
GTTCTGGATTAAACTTTGACTACGTGTGAAAAACCCCACTTGCTAATAAT
ATTTTTTGTGTTAAAATATTTTAATAAACTTAATTGGATTATGGGCGTAT
AAAATACGTTTATGGAGGCGATGAATAGTTATAAAAAGACTTATTGGTTA
CTTATCCGTAAATTAAATTAAATTACCAATTTTTTTTAAAAAAAAAAAAA
AAAAAAAAAA

MIP25022.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5078127..5078900 364..1137 3870 100 Plus
chr3R 27901430 chr3R 5077620..5077982 1..363 1815 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
St2-RB 951 CG16733-PB 1..951 29..979 4755 100 Plus
St2-RA 951 CG16733-PA 1..951 29..979 4755 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
St2-RB 1528 CG16733-RB 1..1137 1..1137 5685 100 Plus
St2-RA 1137 CG16733-RA 1..1137 1..1137 5685 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
St2-PB 316 CG16733-PB 1..316 29..976 1697 100 Plus
St2-PA 316 CG16733-PA 1..316 29..976 1697 100 Plus
St1-PB 338 CG5428-PB 58..327 161..970 427 31.4 Plus
St4-PB 346 CG6704-PB 34..341 104..949 374 29 Plus
St4-PA 346 CG6704-PA 34..341 104..949 374 29 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9252350..9253125 364..1139 3880 100 Plus
3R 32079331 3R 9251843..9252205 1..363 1815 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8993181..8993956 364..1139 3880 100 Plus
3R 31820162 3R 8992674..8993036 1..363 1815 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:59:52 has no hits.

MIP25022.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:48:36 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5078127..5078900 364..1137 100   Plus
chr3R 5077620..5077982 1..363 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:06:45 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
CG16733-RA 1..951 29..979 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:30 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
CG16733-RA 1..951 29..979 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:42:24 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
St2-RA 1..951 29..979 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:48:36 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
St2-RA 1..951 29..979 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:06:45 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
CG16733-RA 1..969 11..979 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:30 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
CG16733-RA 1..969 11..979 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:42:24 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
St2-RA 1..1137 1..1137 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:48:36 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
St2-RA 1..1137 1..1137 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:48:36 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9252350..9253123 364..1137 100   Plus
3R 9251843..9252205 1..363 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:42:24 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5078072..5078845 364..1137 100   Plus
arm_3R 5077565..5077927 1..363 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:40 Download gff for MIP25022.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8993181..8993954 364..1137 100   Plus
3R 8992674..8993036 1..363 100 -> Plus

MIP25022.hyp Sequence

Translation from 0 to 978

> MIP25022.hyp
PKQLKDTGAMQLIYRELEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYV
ELGESIRSLPVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLR
LRSPLIELSALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLP
EQFETVKPRIVYTARNPKDLCVSYYHYFKLLHGMNGDFEQFVDLFLEGHT
PMGSYWRHVLPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLL
DVSTLQKLCDHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMG
NEMSERFDEWTERHMRGSGLNFDYV*

MIP25022.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
St2-PB 316 CG16733-PB 1..316 10..325 1697 100 Plus
St2-PA 316 CG16733-PA 1..316 10..325 1697 100 Plus
St1-PB 338 CG5428-PB 58..327 54..323 427 31.4 Plus
St4-PB 346 CG6704-PB 34..341 35..316 374 29 Plus
St4-PA 346 CG6704-PA 34..341 35..316 374 29 Plus

MIP25022.pep Sequence

Translation from 28 to 978

> MIP25022.pep
MQLIYRELEEDILRRTNAVFPVQNCFVEVLPDQFIIPRKYVELGESIRSL
PVYQDDVWMVSYPRTGSTWAQEMVWLLGHQLDYVAAEQDLRLRSPLIELS
ALFSIDHHETVAQKFGNTVDLVRNLPRPRFARSHLPWPLLPEQFETVKPR
IVYTARNPKDLCVSYYHYFKLLHGMNGDFEQFVDLFLEGHTPMGSYWRHV
LPFWKRSQDDNVLFIKYEDMVKDLPSVVRRCARFLGVQSLLDVSTLQKLC
DHLTFDKMRANKAVNLEKLLPESSSKFIRNGKIGDWRNHMGNEMSERFDE
WTERHMRGSGLNFDYV*

MIP25022.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16584-PA 316 GF16584-PA 1..315 1..315 1540 88.3 Plus
Dana\GF13071-PA 338 GF13071-PA 65..327 52..314 441 33.3 Plus
Dana\GF11151-PA 346 GF11151-PA 31..311 23..281 401 33.9 Plus
Dana\GF24091-PA 733 GF24091-PA 2..196 71..272 323 37.3 Plus
Dana\GF13072-PA 272 GF13072-PA 1..257 50..306 259 28.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15423-PA 316 GG15423-PA 1..314 1..314 1564 91.1 Plus
Dere\GG22874-PA 338 GG22874-PA 65..327 52..314 429 32.6 Plus
Dere\GG22455-PA 346 GG22455-PA 34..311 26..281 374 31 Plus
Dere\GG22875-PA 314 GG22875-PA 38..306 47..314 293 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19934-PA 316 GH19934-PA 1..315 1..315 1358 76.8 Plus
Dgri\GH20666-PA 338 GH20666-PA 58..327 45..314 417 31.4 Plus
Dgri\GH17085-PA 312 GH17085-PA 25..303 36..311 404 31.5 Plus
Dgri\GH22840-PA 346 GH22840-PA 30..324 26..296 398 32.3 Plus
Dgri\GH23313-PA 310 GH23313-PA 37..302 44..312 394 31.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
St2-PB 316 CG16733-PB 1..316 1..316 1697 100 Plus
St2-PA 316 CG16733-PA 1..316 1..316 1697 100 Plus
St1-PB 338 CG5428-PB 58..327 45..314 427 31.4 Plus
St4-PB 346 CG6704-PB 34..341 26..307 374 29 Plus
St4-PA 346 CG6704-PA 34..341 26..307 374 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22042-PA 316 GI22042-PA 1..315 1..315 1369 75.6 Plus
Dmoj\GI19029-PA 345 GI19029-PA 58..327 45..314 444 33.9 Plus
Dmoj\GI21219-PA 349 GI21219-PA 34..311 26..281 399 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13941-PA 290 GL13941-PA 1..288 1..287 1283 80.2 Plus
Dper\GL16876-PA 334 GL16876-PA 58..327 45..314 438 32.9 Plus
Dper\GL20087-PA 350 GL20087-PA 31..345 23..307 425 33.2 Plus
Dper\GL16877-PA 312 GL16877-PA 36..304 45..314 304 30.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14114-PA 316 GA14114-PA 1..315 1..315 1449 81.6 Plus
Dpse\GA24321-PA 334 GA24321-PA 58..327 45..314 441 32.9 Plus
Dpse\GA19797-PA 350 GA19797-PA 31..345 23..307 416 32.3 Plus
Dpse\GA18876-PA 313 GA18876-PA 36..304 45..314 304 30.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23787-PA 316 GM23787-PA 1..315 1..315 1609 94.3 Plus
Dsec\GM16034-PA 338 GM16034-PA 65..327 52..314 424 32.2 Plus
Dsec\GM20241-PA 346 GM20241-PA 34..311 26..281 386 31.4 Plus
Dsec\GM16035-PA 313 GM16035-PA 38..305 47..314 290 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18598-PA 316 GD18598-PA 1..315 1..315 1611 94.3 Plus
Dsim\GD11782-PA 338 GD11782-PA 65..327 52..314 426 32.2 Plus
Dsim\GD25727-PA 346 GD25727-PA 34..311 26..281 371 30.4 Plus
Dsim\GD11783-PA 309 GD11783-PA 38..288 47..297 287 28 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24095-PA 316 GJ24095-PA 1..315 1..315 1398 78.4 Plus
Dvir\GJ19995-PA 345 GJ19995-PA 58..327 45..314 431 32.5 Plus
Dvir\GJ11360-PA 306 GJ11360-PA 25..294 36..308 421 31.8 Plus
Dvir\GJ20821-PA 349 GJ20821-PA 34..311 26..281 415 35.4 Plus
Dvir\GJ11359-PA 400 GJ11359-PA 156..388 72..308 365 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22430-PA 319 GK22430-PA 1..318 1..315 1357 75.8 Plus
Dwil\GK23067-PA 338 GK23067-PA 58..327 45..314 432 32.9 Plus
Dwil\GK19529-PA 344 GK19529-PA 12..310 6..281 385 31.8 Plus
Dwil\GK23068-PA 314 GK23068-PA 36..291 45..299 248 28 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25933-PA 316 GE25933-PA 1..315 1..315 1594 93 Plus
Dyak\GE14312-PA 338 GE14312-PA 65..327 52..314 430 32.6 Plus
Dyak\GE13326-PA 346 GE13326-PA 34..311 26..281 371 30.4 Plus
Dyak\GE14313-PA 317 GE14313-PA 38..305 47..314 294 27 Plus