Clone MIP25505 Report

Search the DGRC for MIP25505

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:255
Well:5
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG32720-RB
Protein status:MIP25505.pep: gold
Sequenced Size:1380

Clone Sequence Records

MIP25505.complete Sequence

1380 bp assembled on 2010-08-26

GenBank Submission: BT125635.1

> MIP25505.complete
ATACTATCAACAGTAAAAAACACATACGAAAATACGAAAAATGGGTCGCA
GTAAGGTGTTAAGAAAGAAGCAATCTAGCAAGAAGCGACGACATACAATT
GATCAAGAAAATACAGACGATTATTATATGACACCCGAAGAAGTACGGCA
ATCGGTTGAGCGGTGGTCATTCCTTTGGCACTGTAGTGATTCTGATTCTG
ATTCTAATTCCGAATCGGAGAGCAGTTCAACGTCATCATTGTTGCAACAT
GATCCATCTCTGTATGGAGACTGGCGTGTGCGGGGTGAAGAATTCAAATT
AGAGACTACCGGCAAGGAAATGCTGATGAATTTAAGCAAATTTCCCTTTC
CGGAGATAATCAAACCACCCGTTTTGCTGGATACTAAGTTGCCCAAAACC
CTGCGGGTTAATCACTGGCCCTATATTACACACAAAATTTTCGACTACGT
AATGCCGGACATATATTTTCGGTCCATGGAGTTCATGAAGAAACCCGTAT
GTGAGGGAGCCGTGGGTTATGATCCTTTGTACTATGGCTCATCAATTTTG
ATCAAACCTCTGTGCAAGTACAGTAAGCCACGCAATTTTTCACCCACATG
GACCAATACTAGCTTGGTGTCCTGGATAGATGGGCGTCGTTTTGCCAAGA
TGGTGAAACGTAATGACTCGCAGATGGGTAATGAGAAGCTACTTCGGTGG
ACTAAGGTTCGCCCGTTTTGGAGCAATAAACTCCTGGCTGGACTTAGAAA
GGACCCGGACGCTAAACTAATTGTAAGGTGGAAGCGTCCCAGGACAAGAT
TTTCTTTTAATCCGGAATCCGATGCGATGGACAAACAATGGGATATGCCC
GAGGAGGACCCGTTGCCATCGGATGAGTTTTACGTAGAATATGTAATGAA
TGATGATCCCGAAACACAACGATCATGGAACTCCTCGTTGTCTGACGATT
CTATGCCGGGAATAACTAAATCCCAGTCTGATCTCAATCTCGAATATTTA
AAGATAAGGCCGATATTAAGACGTTGTCATAGTTCGAGCAGTCTTTTTTA
GTTATTTTAATTGAAACCTTATTGTCTTTACAAGAATTGTTTAAGCACGC
CGCAAAGGGTCCATTACCAAAATTTAAAGTTCATTCAAAAAAACGCCACT
CTCAAGACCCCCTATTCCGATTTCACGCAATTAAAAAGACCAGCAGTTAA
ACGAGGAAAAAGAGCGGCAATTGTAACAGGCGGCAAGCTCATCGATCAGT
TGAAATTAATAAAATACTCAATAAATGCGCTCACAAAAACGTGAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP25505.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7427568..7428860 1293..1 6465 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32720-RB 1011 CG32720-PB 1..1011 41..1051 5055 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG32720-RB 1335 CG32720-RB 31..1323 1..1293 6465 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32720-PB 336 CG32720-PB 1..330 41..1030 1688 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7535637..7536929 1293..1 6465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7543735..7545027 1293..1 6465 100 Minus
Blast to na_te.dros performed 2014-11-27 07:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
transib2 2844 transib2 TRANSIB2 2844bp 2539..2571 189..221 120 84.8 Plus

MIP25505.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:11:39 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7427568..7428860 1..1293 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-26 13:31:17 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RA 1..935 41..975 100 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:44 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RB 1..1011 41..1051 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:39:02 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RB 1..1011 41..1051 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:39 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RB 1..1011 41..1051 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-26 13:31:16 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RA 1..935 41..975 100 == Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:44 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RB 1..1011 41..1051 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:39:02 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RB 31..1323 1..1293 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:39 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
CG32720-RB 31..1323 1..1293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:11:39 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
X 7535637..7536929 1..1293 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:39:02 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7429670..7430962 1..1293 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:44:04 Download gff for MIP25505.complete
Subject Subject Range Query Range Percent Splice Strand
X 7543735..7545027 1..1293 100   Minus

MIP25505.pep Sequence

Translation from 40 to 1050

> MIP25505.pep
MGRSKVLRKKQSSKKRRHTIDQENTDDYYMTPEEVRQSVERWSFLWHCSD
SDSDSNSESESSSTSSLLQHDPSLYGDWRVRGEEFKLETTGKEMLMNLSK
FPFPEIIKPPVLLDTKLPKTLRVNHWPYITHKIFDYVMPDIYFRSMEFMK
KPVCEGAVGYDPLYYGSSILIKPLCKYSKPRNFSPTWTNTSLVSWIDGRR
FAKMVKRNDSQMGNEKLLRWTKVRPFWSNKLLAGLRKDPDAKLIVRWKRP
RTRFSFNPESDAMDKQWDMPEEDPLPSDEFYVEYVMNDDPETQRSWNSSL
SDDSMPGITKSQSDLNLEYLKIRPILRRCHSSSSLF*

MIP25505.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21124-PA 1366 GF21124-PA 21..264 21..260 253 33.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:55:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17618-PA 708 GG17618-PA 1..306 1..312 931 60.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32720-PB 336 CG32720-PB 1..336 1..336 1815 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17466-PA 511 GM17466-PA 1..309 1..312 1468 87.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16150-PA 511 GD16150-PA 1..309 1..312 1391 85.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17520-PA 761 GE17520-PA 1..308 1..312 945 61.5 Plus

MIP25505.hyp Sequence

Translation from 40 to 1050

> MIP25505.hyp
MGRSKVLRKKQSSKKRRHTIDQENTDDYYMTPEEVRQSVERWSFLWHCSD
SDSDSNSESESSSTSSLLQHDPSLYGDWRVRGEEFKLETTGKEMLMNLSK
FPFPEIIKPPVLLDTKLPKTLRVNHWPYITHKIFDYVMPDIYFRSMEFMK
KPVCEGAVGYDPLYYGSSILIKPLCKYSKPRNFSPTWTNTSLVSWIDGRR
FAKMVKRNDSQMGNEKLLRWTKVRPFWSNKLLAGLRKDPDAKLIVRWKRP
RTRFSFNPESDAMDKQWDMPEEDPLPSDEFYVEYVMNDDPETQRSWNSSL
SDDSMPGITKSQSDLNLEYLKIRPILRRCHSSSSLF*

MIP25505.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG32720-PB 336 CG32720-PB 1..336 1..336 1815 100 Plus