Clone MIP25735 Report

Search the DGRC for MIP25735

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:257
Well:35
Vector:pOT2
Associated Gene/TranscriptCG3355-RA
Protein status:MIP25735.pep: gold
Sequenced Size:1099

Clone Sequence Records

MIP25735.complete Sequence

1099 bp assembled on 2011-01-11

GenBank Submission: BT125897.1

> MIP25735.complete
TCAACTCCGGACAAGATGCGCGTCTACCTGGCCCTGCCGCTCCTGCTGCT
GGGCATCGGCCTCAGTTTGGCCCAGTACCAGTATCAAGCGCCCCACCAAA
CCCTCGCCCAGCAATTCGCCGACGTGGTGGATGTGGTCGATCCTGCAGAA
CAATCTATCAAAGCAGTGCGACCACCGAAGAGCCGCAATCAGTGCACCGC
CAAGCAGAACTGCTTCTGCGGCACTCCGAATGTCAACCGTATCGTGGGCG
GCCAGCAGGTGCGCTCCAACAAGTATCCTTGGACCGCCCAATTGGTAAAG
GGTCGTCATTATCCCCGCCTCTTCTGCGGCGGTTCCCTAATCAATGATCG
CTATGTGCTGACCGCCGCCCATTGTGTGCATGGGAACAGGGATCAGATCA
CCATTCGCCTGCTCCAGATCGACAGATCCTCCCGGGATCCCGGCATTGTG
CGCAAGGTCGTCCAGACCACTGTGCATCCTAACTACGATCCCAACCGGAT
TGTCAACGATGTGGCGCTGCTCAAGCTGGAGTCCCCTGTTCCACTGACTG
GAAACATGCGTCCAGTCTGTCTGCCCGAGGCCAATCATAACTTTGATGGC
AAGACCGCTGTGGTTGCTGGCTGGGGTTTGATCAAGGAGGGCGGCGTCAC
CTCCAACTATCTGCAGGAGGTCAATGTGCCCGTCATCACCAACGCGCAGT
GTCGCCAGACGCGCTACAAGGACAAGATTGCCGAGGTGATGCTCTGCGCC
GGATTGGTGCAGCAGGGTGGCAAGGACGCCTGCCAGGGCGACAGTGGTGG
CCCACTGATCGTCAACGAGGGTCGCTACAAGCTGGCCGGCGTGGTGTCCT
TCGGCTACGGATGTGCACAGAAGAATGCGCCGGGTGTCTACGCCAGGGTG
AGCAAGTTCCTGGACTGGATCCGTAAGAACACCGCCGACGGCTGCTACTG
CCAGAGTTAGATCATTTGGCTAAAAAAAAACTCATTTCCTTGCCTCATTC
CTAAGTTATTCTAAATTATTGAAAAAAGAAGTTCACAGCAAATAAATCCA
TCAAATGCTTTAAGTCTGTTTCGTTTAAGAAAAAAAAAAAAAAAAAAAA

MIP25735.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4651548..4652018 607..1078 2220 98.5 Plus
chr2L 23010047 chr2L 4650890..4651282 215..607 1935 99.5 Plus
chr2L 23010047 chr2L 4650600..4650813 1..214 1070 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-RA 945 CG3355-PA 1..945 16..960 4725 100 Plus
CG3355-RB 651 CG3355-PB 1..592 16..607 2960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-RA 1096 CG3355-RA 21..1096 1..1076 5380 100 Plus
CG3355-RB 1399 CG3355-RB 73..679 1..607 3035 100 Plus
CG3355-RB 1399 CG3355-RB 945..1399 607..1061 2275 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-PA 314 CG3355-PA 1..314 16..957 1550 100 Plus
CG3355-PB 216 CG3355-PB 1..197 16..606 923 100 Plus
CG4613-PC 374 CG4613-PC 122..372 187..951 834 60.7 Plus
CG4613-PB 374 CG4613-PB 122..372 187..951 834 60.7 Plus
CG18735-PA 364 CG18735-PA 58..321 142..951 630 47.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4652423..4652894 607..1078 2360 100 Plus
2L 23513712 2L 4651765..4652157 215..607 1965 100 Plus
2L 23513712 2L 4651475..4651688 1..214 1070 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4652423..4652894 607..1078 2360 100 Plus
2L 23513712 2L 4651765..4652157 215..607 1965 100 Plus
2L 23513712 2L 4651475..4651688 1..214 1070 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:50:51 has no hits.

MIP25735.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:59:22 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4651548..4652018 607..1079 98   Plus
chr2L 4650890..4651281 215..606 99 -> Plus
chr2L 4650600..4650813 1..214 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-11 10:26:17 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 1..945 16..960 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:40:13 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 1..945 16..960 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:59:22 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 1..945 16..960 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:26:16 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 73..1133 1..1061 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:40:13 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 21..1096 1..1076 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:59:22 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
CG3355-RA 21..1096 1..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:59:22 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4652423..4652894 607..1079 99   Plus
2L 4651765..4652156 215..606 100 -> Plus
2L 4651475..4651688 1..214 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:40:13 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4652423..4652894 607..1079 99   Plus
arm_2L 4651765..4652156 215..606 100 -> Plus
arm_2L 4651475..4651688 1..214 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:54:50 Download gff for MIP25735.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4652423..4652894 607..1079 99   Plus
2L 4651765..4652156 215..606 100 -> Plus
2L 4651475..4651688 1..214 100 -> Plus

MIP25735.pep Sequence

Translation from 0 to 959

> MIP25735.pep
STPDKMRVYLALPLLLLGIGLSLAQYQYQAPHQTLAQQFADVVDVVDPAE
QSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVK
GRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPGIV
RKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDG
KTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCA
GLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARV
SKFLDWIRKNTADGCYCQS*

MIP25735.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21354-PA 315 GF21354-PA 1..315 6..319 1538 91.4 Plus
Dana\GF25196-PA 379 GF25196-PA 104..377 48..317 856 59.2 Plus
Dana\GF11617-PA 354 GF11617-PA 53..316 48..317 644 48.6 Plus
Dana\GF11616-PA 379 GF11616-PA 122..372 70..318 623 47.5 Plus
Dana\GF13273-PA 350 GF13273-PA 79..342 58..317 594 47.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25012-PA 314 GG25012-PA 1..314 6..319 1541 95.2 Plus
Dere\GG13724-PA 376 GG13724-PA 124..374 63..317 839 61.5 Plus
Dere\GG20744-PA 364 GG20744-PA 6..321 15..317 635 41.6 Plus
Dere\GG20743-PA 372 GG20743-PA 115..365 70..318 613 47.1 Plus
Dere\GG22144-PA 343 GG22144-PA 81..335 71..317 581 46.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13131-PA 318 GH13131-PA 1..317 6..318 1368 78.9 Plus
Dgri\GH14456-PA 359 GH14456-PA 107..357 63..317 831 60.7 Plus
Dgri\GH20777-PA 356 GH20777-PA 41..313 39..317 636 47.2 Plus
Dgri\GH20776-PA 378 GH20776-PA 112..371 55..318 630 47.8 Plus
Dgri\GH21133-PA 349 GH21133-PA 71..330 64..319 578 45.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-PA 314 CG3355-PA 1..314 6..319 1673 100 Plus
CG3355-PB 216 CG3355-PB 1..197 6..202 1046 100 Plus
CG4613-PC 374 CG4613-PC 122..372 63..317 834 60.7 Plus
CG4613-PB 374 CG4613-PB 122..372 63..317 834 60.7 Plus
CG18735-PA 364 CG18735-PA 58..321 48..317 630 47.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22815-PA 312 GI22815-PA 1..312 6..319 1323 80.9 Plus
Dmoj\GI13599-PA 364 GI13599-PA 99..363 46..318 872 60.4 Plus
Dmoj\GI20861-PA 359 GI20861-PA 6..317 14..317 651 45.3 Plus
Dmoj\GI20860-PA 396 GI20860-PA 131..389 56..318 610 46.5 Plus
Dmoj\GI13812-PA 377 GI13812-PA 109..375 59..319 541 43.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14423-PA 314 GL14423-PA 1..314 6..319 1467 92.1 Plus
Dper\GL20989-PA 369 GL20989-PA 117..367 63..317 833 61.5 Plus
Dper\GL17517-PA 363 GL17517-PA 3..318 9..317 665 43 Plus
Dper\GL17516-PA 377 GL17516-PA 112..370 56..318 612 46.1 Plus
Dper\GL26150-PA 373 GL26150-PA 104..369 59..317 552 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17401-PA 314 GA17401-PA 1..314 6..319 1469 92.1 Plus
Dpse\GA18302-PA 369 GA18302-PA 117..367 63..317 841 61.9 Plus
Dpse\GA15058-PA 364 GA15058-PA 55..319 58..317 665 48.9 Plus
Dpse\GA18150-PA 375 GA18150-PA 110..368 56..318 612 46.1 Plus
Dpse\GA21676-PA 333 GA21676-PA 70..325 70..317 589 47.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18483-PA 314 GM18483-PA 1..314 6..319 1663 99.4 Plus
Dsec\GM24545-PA 394 GM24545-PA 142..392 63..317 828 60.3 Plus
Dsec\GM15687-PA 364 GM15687-PA 58..321 48..317 643 47.8 Plus
Dsec\GM15686-PA 372 GM15686-PA 115..365 70..318 614 47.1 Plus
Dsec\GM15869-PA 313 GM15869-PA 66..305 85..317 553 46.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23293-PA 314 GD23293-PA 1..314 6..319 1668 99.7 Plus
Dsim\GD12618-PA 394 GD12618-PA 142..392 63..317 827 60.3 Plus
Dsim\GD25166-PA 364 GD25166-PA 58..321 48..317 638 47.5 Plus
Dsim\GD25165-PA 372 GD25165-PA 115..365 70..318 612 47.1 Plus
Dsim\GD11631-PA 354 GD11631-PA 91..346 70..317 580 47.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23363-PA 318 GJ23363-PA 1..318 6..319 1344 82.7 Plus
Dvir\GJ13936-PA 357 GJ13936-PA 92..355 46..317 847 59.9 Plus
Dvir\GJ20596-PA 354 GJ20596-PA 40..315 39..317 633 46.9 Plus
Dvir\GJ21756-PA 345 GJ21756-PA 85..337 70..317 611 47.7 Plus
Dvir\GJ20595-PA 373 GJ20595-PA 108..367 56..319 610 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23752-PA 324 GK23752-PA 21..323 22..318 1413 88.1 Plus
Dwil\GK10288-PA 384 GK10288-PA 107..384 48..319 829 56.7 Plus
Dwil\GK15653-PA 375 GK15653-PA 60..331 44..317 659 46.8 Plus
Dwil\GK15652-PA 366 GK15652-PA 109..359 70..318 619 47.1 Plus
Dwil\GK15931-PA 357 GK15931-PA 95..349 71..317 573 45.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18301-PA 314 GE18301-PA 1..314 6..319 1564 97.8 Plus
Dyak\GE20019-PA 374 GE20019-PA 122..372 63..317 833 61.1 Plus
Dyak\GE13676-PA 364 GE13676-PA 58..321 48..317 630 47.1 Plus
Dyak\GE13675-PA 378 GE13675-PA 121..371 70..318 614 47.1 Plus
Dyak\GE12225-PA 359 GE12225-PA 96..351 70..317 579 47.5 Plus

MIP25735.hyp Sequence

Translation from 0 to 959

> MIP25735.hyp
STPDKMRVYLALPLLLLGIGLSLAQYQYQAPHQTLAQQFADVVDVVDPAE
QSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWTAQLVK
GRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPGIV
RKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDG
KTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCA
GLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARV
SKFLDWIRKNTADGCYCQS*

MIP25735.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG3355-PA 314 CG3355-PA 1..314 6..319 1673 100 Plus
CG3355-PB 216 CG3355-PB 1..197 6..202 1046 100 Plus
CG4613-PC 374 CG4613-PC 122..372 63..317 834 60.7 Plus
CG4613-PB 374 CG4613-PB 122..372 63..317 834 60.7 Plus
CG18735-PA 364 CG18735-PA 58..321 48..317 630 47.1 Plus