Clone MIP26115 Report

Search the DGRC for MIP26115

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:261
Well:15
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42300-RA
Protein status:MIP26115.pep: gold
Sequenced Size:719

Clone Sequence Records

MIP26115.complete Sequence

719 bp assembled on 2010-08-23

GenBank Submission: BT125595.1

> MIP26115.complete
CTGGATTTGCAATTTAAAAAGCGTGTGAATAAAATTTATGATCAAAATGG
ACCCGAAATCCCACCAAAAGCTCTTCAAGGAAATGGCAGAAGTCGTGTCC
AATTCCAGCGATGACGGGGAGAAGTTGCTAACCAAAAACTCTAGCAACAC
CATCGAGAAGTCCGAGGAAGTCTGCAAGGAGCGCCCCGAAGCTGTGGAGC
AGATGCGCATCGATGTCAATAACTCACTTGAGGACACGAACATGAATGCG
GTGGAATCAGAAGCTCAAAAGAATATCGCCGGCCTTGATGAGGACCTTAT
CATGGAAGACTTCGGCGTCGAGGTCGTCCCGTTCCACGATCCCTGGTCCA
AGCTATTGATAAAGCACCCCGTGCGCAACAAAAGGTGCGGCCATATCTAC
GACCGCGAAACGGTTTTAATGATCATCAAGGACAACATTGGCATCCTATG
CCCGGTGCGCGACTGTCCCAACTTGTCCGACATCAAGTTAGAGCACCTGG
TCAAGGACCCCGACGTGGAGCAGGAGTTGCAAAAGCGCAAGTCCGACAAG
ATCCAGAATGAAACTTCCTCGGATGAGGACTAAGAACAGGCAGGTCATTA
ATTATATATAATAAGCGCCTTTAAACTTTAGATTTTAATATGACTTCAAG
TCTTGTTGAGAATTAACTTTATAAATAAAAAACACTCCTTTGGAAAAAAA
AAAAAAAAAAAAAAAAAAA

MIP26115.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15445207..15445809 693..91 3015 100 Minus
chrX 22417052 chrX 15464865..15465470 693..91 2875 98.7 Minus
chrX 22417052 chrX 15467035..15467369 605..271 820 83 Minus
chr3L 24539361 chr3L 17469278..17469572 286..580 560 79.3 Plus
chrX 22417052 chrX 15445875..15445966 92..1 460 100 Minus
chrX 22417052 chrX 15465527..15465618 92..1 415 96.7 Minus
chrX 22417052 chrX 15467435..15467529 226..132 385 93.7 Minus
chr3L 24539361 chr3L 17469095..17469181 133..219 270 87.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-RA 546 CG42300-PA 1..546 38..583 2730 100 Plus
CG42299-RA 549 CG42299-PA 1..549 38..583 2590 98.5 Plus
cerv-RD 693 CG15645-PD 363..693 271..601 800 82.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-RA 726 CG42300-RA 34..726 1..693 3465 100 Plus
CG42299-RA 679 CG42299-RA 1..679 18..693 3210 98.5 Plus
cerv-RD 1141 CG15645-RD 645..979 271..605 820 83 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-PA 181 CG42300-PA 1..181 38..580 938 100 Plus
CG42299-PA 182 CG32584-PA 1..182 38..580 919 98.4 Plus
cerv-PD 230 CG15645-PD 17..230 62..598 502 54.7 Plus
cerv-PA 230 CG15645-PA 17..230 62..598 502 54.7 Plus
cerv-PC 177 CG15645-PC 16..177 134..598 475 61.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15555251..15555855 695..91 3025 100 Minus
X 23542271 X 15574945..15575552 695..91 2885 98.7 Minus
X 23542271 X 15577148..15577482 605..271 820 83 Minus
3L 28110227 3L 17479760..17480054 286..580 560 79.3 Plus
X 23542271 X 15555921..15556012 92..1 460 100 Minus
X 23542271 X 15575609..15575700 92..1 415 96.7 Minus
X 23542271 X 15577548..15577642 226..132 385 93.7 Minus
3L 28110227 3L 17479577..17479663 133..219 270 87.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15563349..15563953 695..91 3025 100 Minus
X 23527363 X 15583043..15583650 695..91 2895 98.6 Minus
X 23527363 X 15585246..15585580 605..271 820 82.9 Minus
3L 28103327 3L 17472860..17473154 286..580 560 79.3 Plus
X 23527363 X 15564019..15564110 92..1 460 100 Minus
X 23527363 X 15583707..15583798 92..1 415 96.7 Minus
X 23527363 X 15585646..15585740 226..132 385 93.6 Minus
3L 28103327 3L 17472677..17472763 133..219 270 87.3 Plus
3L 28103327 3L 17472514..17472570 66..122 165 85.9 Plus
Blast to na_te.dros performed on 2014-11-27 14:04:59 has no hits.

MIP26115.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:32:06 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15445875..15445966 1..92 100   Minus
chrX 15445207..15445807 93..693 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-23 10:01:22 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 1..546 38..583 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:50 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 1..546 38..583 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:07:55 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 1..546 38..583 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:06 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 1..546 38..583 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-23 10:01:21 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..679 18..693 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:50 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42299-RA 1..679 18..693 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:07:55 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 34..726 1..693 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:06 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
CG42300-RA 34..726 1..693 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:32:06 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
X 15555921..15556012 1..92 100   Minus
X 15555253..15555853 93..693 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:07:55 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15449954..15450045 1..92 100   Minus
arm_X 15449286..15449886 93..693 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:02 Download gff for MIP26115.complete
Subject Subject Range Query Range Percent Splice Strand
X 15564019..15564110 1..92 100   Minus
X 15563351..15563951 93..693 100 <- Minus

MIP26115.pep Sequence

Translation from 37 to 582

> MIP26115.pep
MIKMDPKSHQKLFKEMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERP
EAVEQMRIDVNNSLEDTNMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFH
DPWSKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIK
LEHLVKDPDVEQELQKRKSDKIQNETSSDED*

MIP26115.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22252-PA 248 GF22252-PA 86..222 47..167 200 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\cerv-PA 241 GG19392-PA 19..231 11..178 354 40.8 Plus
Dere\GG11876-PA 240 GG11876-PA 19..230 11..178 347 40.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22621-PA 226 GH22621-PA 73..225 34..181 222 31.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-PA 181 CG42300-PA 1..181 1..181 938 100 Plus
CG42299-PA 182 CG32584-PA 1..182 1..181 919 98.4 Plus
cerv-PD 230 CG15645-PD 17..224 9..181 485 54.3 Plus
cerv-PA 230 CG15645-PA 17..224 9..181 485 54.3 Plus
cerv-PC 177 CG15645-PC 16..171 33..181 458 61.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15639-PA 226 GI15639-PA 73..224 34..181 202 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25912-PA 232 GL25912-PA 113..218 69..171 212 40.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25188-PA 232 GA25188-PA 120..218 76..171 203 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22549-PA 232 GM22549-PA 18..218 10..172 435 50.7 Plus
Dsec\GM22550-PA 200 GM22550-PA 36..186 32..172 413 58.3 Plus
Dsec\qjt-PA 233 GM25704-PA 17..231 9..181 402 45.6 Plus
Dsec\GM22546-PA 98 GM22546-PA 1..84 89..172 282 61.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\cerv-PA 232 GD15792-PA 18..223 10..177 455 51.5 Plus
Dsim\qjt-PA 233 GD14711-PA 17..231 9..181 400 45.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19226-PA 225 GJ19226-PA 136..222 93..179 195 46 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19230-PA 226 GK19230-PA 61..218 20..177 203 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\cerv-PA 238 GE16038-PA 19..234 11..181 410 44 Plus
Dyak\GE26335-PA 238 GE26335-PA 19..234 11..181 392 42.6 Plus

MIP26115.hyp Sequence

Translation from 37 to 582

> MIP26115.hyp
MIKMDPKSHQKLFKEMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERP
EAVEQMRIDVNNSLEDTNMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFH
DPWSKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIK
LEHLVKDPDVEQELQKRKSDKIQNETSSDED*

MIP26115.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG42300-PA 181 CG42300-PA 1..181 1..181 938 100 Plus
CG42299-PA 182 CG32584-PA 1..182 1..181 919 98.4 Plus
cerv-PD 230 CG15645-PD 17..224 9..181 485 54.3 Plus
cerv-PA 230 CG15645-PA 17..224 9..181 485 54.3 Plus
cerv-PC 177 CG15645-PC 16..171 33..181 458 61.5 Plus