Clone MIP26173 Report

Search the DGRC for MIP26173

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:261
Well:73
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptl(3)72Dr-RA
Protein status:MIP26173.pep: gold
Sequenced Size:1166

Clone Sequence Records

MIP26173.complete Sequence

1166 bp assembled on 2010-08-20

GenBank Submission: BT125583.1

> MIP26173.complete
GCCACTAGCTCGTAGTCTGAAATCCGAAGAAGACGATGGCGGAAAGCGCT
TATACCGATGCGCCGTACCTCAACCGCGTACCGACAGTTGGTGTGATGTG
CATCGATATCGCCACGCAACTGCAGCAGAACTTTAGTGGTGCATATCACA
GCTATTTGGCTGCATCCTATGTCAAATTTTTGGAGGCATCCGGTGCGCAT
GTGGTTCCCATTTGGATCGGCCGAGAACGAGCTTACTATGCGTTGATGAT
GAGCCAGTTAAATGGCATTCTTCTGCCAGGTGGAGCCGTGTTCATCGACG
AGGCTGATAGGCAAGCCAATCCGGATGTGACCAGCGATTGCGTCCGGAGT
GCCGAGCTCATCTACCAATTGGCTATGGAGCGTAATATGCGGGCGAAGAA
GTTGGATGATCGTGGCGCATACTTTCCCGTTTGGGGAACTTGTCTTGGCT
TCCAGTTGATCCTTATTCACGCTGCCGAAGCACCGAATGTTCGAATCGCC
TGTCAGCCCATGAGGGAGGCGATGCCAGTTACTCTGACCGATGACTATCA
ACAATCACAACTGCTTGGAAGTCTGCCGAAATCGGTTGCCGATGAGATGG
AGAAGCACCCATTTGCCTGCCATCAGCATCGGTATTGCATCACTAAAGAG
AGTTTGGAATCCTATGGTCTAGCTAAGGATTGGCATCCCCTGGCCACTCA
GAAGGACACTTCAGGACTGGAATTCATCACGATTGTCGAGCACAGGCGTT
TTCCCATCTTTGGATGTCAGTTTCATCCTGAGCGCGCTGCATTTGAGCAG
CTTTTCAACTCACCGGACAAATGTTACATGGCGCATTCTCGCATGGGTAT
CGATTTGTCCCAAATCTTTGGCAGTCGGTTTGTTGACTTCTGCCGCCGCA
ACAACAATCAGTTCGAAAGTGACAAATTAAAAACCAGACATCTCATTTGG
AACTGGCAGCCCGTTTTCTCTGGCAAGTTCAAGGGCTCCAACTGGCAGCA
GTGCTATCTATTTGAGAAGAACGTGGACTATTCGGAAGAGCCGGATGATT
CTGAGGAGCTTCGCTCATCTTAAGTATTGTGATACACAAGAATTCATGTA
ATTATTAAGCTAATTAATAAATTAGACTAAAACTAGCCAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

MIP26173.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16228224..16229148 214..1138 4520 99.2 Plus
chr3L 24539361 chr3L 16227409..16227623 1..215 1075 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-RA 1038 CG32154-PA 1..1038 36..1073 5190 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-RA 1138 CG32154-RA 1..1138 1..1138 5690 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-PA 345 CG32154-PA 1..345 36..1070 1851 100 Plus
l(3)72Dp-PA 373 CG32155-PA 26..331 81..1058 516 34.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16238538..16239469 214..1145 4645 99.9 Plus
3L 28110227 3L 16237723..16237937 1..215 1075 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16231638..16232569 214..1145 4645 99.8 Plus
3L 28103327 3L 16230823..16231037 1..215 1075 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:45:04 has no hits.

MIP26173.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:08:01 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16228225..16229148 215..1138 99   Plus
chr3L 16227409..16227622 1..214 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:06:49 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
CG32154-RA 1..1038 36..1073 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:34 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
CG32154-RA 1..1038 36..1073 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:36:39 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dr-RA 1..1038 36..1073 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:01 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dr-RA 1..1038 36..1073 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:06:48 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
CG32154-RA 1..1038 36..1073 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:34 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
CG32154-RA 1..1038 36..1073 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:36:39 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dr-RA 1..1138 1..1138 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:01 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)72Dr-RA 1..1138 1..1138 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:08:01 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16238539..16239462 215..1138 100   Plus
3L 16237723..16237936 1..214 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:36:39 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16231639..16232562 215..1138 100   Plus
arm_3L 16230823..16231036 1..214 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:44 Download gff for MIP26173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16231639..16232562 215..1138 100   Plus
3L 16230823..16231036 1..214 100 -> Plus

MIP26173.pep Sequence

Translation from 35 to 1072

> MIP26173.pep
MAESAYTDAPYLNRVPTVGVMCIDIATQLQQNFSGAYHSYLAASYVKFLE
ASGAHVVPIWIGRERAYYALMMSQLNGILLPGGAVFIDEADRQANPDVTS
DCVRSAELIYQLAMERNMRAKKLDDRGAYFPVWGTCLGFQLILIHAAEAP
NVRIACQPMREAMPVTLTDDYQQSQLLGSLPKSVADEMEKHPFACHQHRY
CITKESLESYGLAKDWHPLATQKDTSGLEFITIVEHRRFPIFGCQFHPER
AAFEQLFNSPDKCYMAHSRMGIDLSQIFGSRFVDFCRRNNNQFESDKLKT
RHLIWNWQPVFSGKFKGSNWQQCYLFEKNVDYSEEPDDSEELRSS*

MIP26173.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10313-PA 328 GF10313-PA 4..323 13..332 1244 69.1 Plus
Dana\GF24165-PA 372 GF24165-PA 24..327 15..336 544 34.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15967-PA 338 GG15967-PA 1..338 1..345 1524 81.4 Plus
Dere\GG15966-PA 370 GG15966-PA 26..328 16..341 535 35.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15863-PA 332 GH15863-PA 13..332 14..334 896 51.7 Plus
Dgri\GH15860-PA 380 GH15860-PA 35..343 16..344 522 32.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-PA 345 CG32154-PA 1..345 1..345 1851 100 Plus
l(3)72Dp-PA 373 CG32155-PA 26..331 16..341 516 34.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12644-PA 333 GI12644-PA 14..332 17..341 807 47.7 Plus
Dmoj\GI12643-PA 371 GI12643-PA 31..330 16..338 514 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17839-PA 115 GL17839-PA 22..88 13..78 169 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16719-PA 319 GA16719-PA 11..317 15..332 1111 63.5 Plus
Dpse\GA16720-PA 374 GA16720-PA 22..316 13..328 518 34.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25601-PA 345 GM25601-PA 1..345 1..345 1783 94.2 Plus
Dsec\GM25600-PA 373 GM25600-PA 26..315 16..326 538 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14609-PA 345 GD14609-PA 1..345 1..345 1773 93.6 Plus
Dsim\GD14608-PA 373 GD14608-PA 26..315 16..326 538 35.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12765-PA 357 GJ12765-PA 32..351 15..332 866 51.7 Plus
Dvir\GJ12763-PA 374 GJ12763-PA 32..321 16..327 543 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15548-PA 328 GK15548-PA 13..322 16..332 1028 58 Plus
Dwil\GK16552-PA 373 GK16552-PA 32..321 16..326 528 34.8 Plus
Dwil\GK16551-PA 134 GK16551-PA 9..127 12..137 418 62.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23119-PA 346 GE23119-PA 1..345 1..345 1599 83.2 Plus
Dyak\GE19535-PA 346 GE19535-PA 1..345 1..345 1598 82.9 Plus
Dyak\GE19534-PA 370 GE19534-PA 26..333 16..340 532 34.4 Plus
Dyak\GE23118-PA 370 GE23118-PA 26..333 16..340 531 34.4 Plus

MIP26173.hyp Sequence

Translation from 35 to 1072

> MIP26173.hyp
MAESAYTDAPYLNRVPTVGVMCIDIATQLQQNFSGAYHSYLAASYVKFLE
ASGAHVVPIWIGRERAYYALMMSQLNGILLPGGAVFIDEADRQANPDVTS
DCVRSAELIYQLAMERNMRAKKLDDRGAYFPVWGTCLGFQLILIHAAEAP
NVRIACQPMREAMPVTLTDDYQQSQLLGSLPKSVADEMEKHPFACHQHRY
CITKESLESYGLAKDWHPLATQKDTSGLEFITIVEHRRFPIFGCQFHPER
AAFEQLFNSPDKCYMAHSRMGIDLSQIFGSRFVDFCRRNNNQFESDKLKT
RHLIWNWQPVFSGKFKGSNWQQCYLFEKNVDYSEEPDDSEELRSS*

MIP26173.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)72Dr-PA 345 CG32154-PA 1..345 1..345 1851 100 Plus
l(3)72Dp-PA 373 CG32155-PA 26..331 16..341 516 34.7 Plus