Clone MIP26267 Report

Search the DGRC for MIP26267

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:262
Well:67
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG41106-RA
Protein status:MIP26267.pep: gold
Sequenced Size:577

Clone Sequence Records

MIP26267.complete Sequence

577 bp assembled on 2010-08-24

GenBank Submission: BT125622.1

> MIP26267.complete
AAAACAGATTTCGTCTTTACCGAAAAAAATTATTATCGTGTCAGTAAAAA
TTCTGCAAATGATGCGGCCTTGCTGCTGTTCGTAAAATAGTAATTAACGG
GGCAATCAGCATTGCAGCGCCCAGGGGACCGCATTAGAGTCAACTCCTTT
AGCAACAGAATGGAGGACACAGATCAGGAAGACCTGCTGGCTTTCGAGCG
TCGGCTGGCTGAGGTGGTAAACACTGAGAAACGGAGTTCACTCCGCTGGC
GCTTTGTTCTGGGCGCCATCTTCGCCTGCTCGGCGATCAGTGCCTGTCAT
TGGGTTCGGGATGCCAAGGAAAGCGAGTCGGTGGTTTTCCAAATCCTGTC
CAGTCAAAGCGCCTTTGCCTTCTCCCTGGCAACCATATGCCTGCTAATCT
TTTATGGATTCAATCACGCCACTAAGCAGGACCCCAGTATCCTGCGTGAC
ACCCAAGAAATGCTGTCTCCGTTCCGCCTTAACATTGATAACCAGGGACG
TCTCATCCTACTTCCACGGCAGACAGAGTAGCTGAATATATGTATATCCC
CAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP26267.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 22341371..22341920 2..551 2735 99.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG41106-RA 372 CG41106-PA 1..372 160..531 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG41106-RA 957 CG41106-RA 7..556 2..551 2750 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG41106-PA 123 CG41106-PA 1..123 160..528 541 100 Plus
CG8009-PA 127 CG8009-PA 1..122 160..525 190 37.7 Plus
CG8009-PB 131 CG8009-PB 1..126 160..525 174 36.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 22945327..22945881 2..556 2775 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 22930419..22930973 2..556 2775 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:15:58 has no hits.

MIP26267.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:42:52 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 22341370..22341920 1..551 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-24 13:26:15 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 1..372 160..531 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:02 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 1..372 160..531 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:33 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 1..372 160..531 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:42:52 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 1..372 160..531 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-24 13:26:14 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 6..556 1..551 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:01 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 6..556 1..551 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:33 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 6..556 1..551 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:52 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
CG41106-RA 6..556 1..551 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:42:52 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
X 22945326..22945876 1..551 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:33 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 22347162..22347712 1..551 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:14 Download gff for MIP26267.complete
Subject Subject Range Query Range Percent Splice Strand
X 22930418..22930968 1..551 99   Plus

MIP26267.pep Sequence

Translation from 159 to 530

> MIP26267.pep
MEDTDQEDLLAFERRLAEVVNTEKRSSLRWRFVLGAIFACSAISACHWVR
DAKESESVVFQILSSQSAFAFSLATICLLIFYGFNHATKQDPSILRDTQE
MLSPFRLNIDNQGRLILLPRQTE*

MIP26267.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22019-PA 125 GF22019-PA 6..122 3..119 299 44.4 Plus
Dana\GF10599-PA 127 GF10599-PA 1..123 1..123 213 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19757-PA 123 GG19757-PA 1..123 1..123 586 89.4 Plus
Dere\GG15442-PA 127 GG15442-PA 1..123 1..123 211 37.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14952-PA 130 GH14952-PA 1..124 1..123 205 35.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG41106-PA 123 CG41106-PA 1..123 1..123 624 100 Plus
CG8009-PA 127 CG8009-PA 1..122 1..122 205 37.7 Plus
CG8009-PB 131 CG8009-PB 1..126 1..122 189 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes100-PA 159 GI11479-PA 1..124 1..123 203 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15473-PA 131 GL15473-PA 1..127 1..123 182 33.9 Plus
Dper\GL23141-PA 126 GL23141-PA 1..121 1..122 180 35.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23834-PA 131 GA23834-PA 1..127 1..123 182 33.9 Plus
Dpse\GA27154-PA 126 GA27154-PA 1..121 1..122 176 35.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10063-PA 123 GM10063-PA 1..123 1..123 584 89.4 Plus
Dsec\GM25217-PA 127 GM25217-PA 1..123 1..123 213 37.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17576-PA 123 GD17576-PA 1..123 1..123 589 90.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13672-PA 129 GJ13672-PA 1..122 1..121 204 36.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12275-PA 127 GK12275-PA 1..123 1..123 212 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17951-PA 1425 GE17951-PA 1303..1425 1..123 588 89.4 Plus
Dyak\GE21752-PA 127 GE21752-PA 1..123 1..123 212 37.4 Plus

MIP26267.hyp Sequence

Translation from 159 to 530

> MIP26267.hyp
MEDTDQEDLLAFERRLAEVVNTEKRSSLRWRFVLGAIFACSAISACHWVR
DAKESESVVFQILSSQSAFAFSLATICLLIFYGFNHATKQDPSILRDTQE
MLSPFRLNIDNQGRLILLPRQTE*

MIP26267.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG41106-PA 123 CG41106-PA 1..123 1..123 624 100 Plus
CG8009-PA 127 CG8009-PA 1..122 1..122 205 37.7 Plus
CG8009-PB 131 CG8009-PB 1..126 1..122 189 36.5 Plus