Clone MIP26281 Report

Search the DGRC for MIP26281

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:262
Well:81
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG11600-RB
Protein status:MIP26281.pep: gold
Sequenced Size:1355

Clone Sequence Records

MIP26281.complete Sequence

1355 bp assembled on 2010-08-23

GenBank Submission: BT125604.1

> MIP26281.complete
AAAACCATTGCAATATGTTGTTGATGGAGCTCGTGATTTTCTTTGACTGG
CTGTTGATCGTCTCTGGTATGCCGAAGGTGAAGTTTGGCCTCCAAAATTT
TACGGGTCGTGGTAAAGATTACCGCATCAAAGTGATTACTGGGATTCTTA
TAATAGACAAGTACGGCTACTCAGTGGAGACGCACACGGTTCGCACTGGA
GATGGATACATTCTGGATATGTTTCGGATTCCCTCATCACCCAACTGCAA
GGAGGACGGTTTCAAGCCGTCTGTTCTTATCCAGCACGGACTGATCAGCC
TGGCCGATTCCTTCCTGGTGACGGGACCGAGGAGCGGACTTCCATTCATG
CTGGCCGATCGCTGCTACGACGTGTGGCTGAGCAACAGCCGGGGAGTCCG
CTACTCGCAGCGCCACATCCGGCTGAAGGCTTCCCAGGATGCCTTCTGGC
GCTTTAGCTGGCACGAAATGGGAATGGAGGACCTGCCCGCCATGATCGAC
TACATCCTGTCCACGACAAACGAGGAAGCGTTGCACTTCGTTTGCCATTC
TCAGGGATGCACCACCCTACTGGTTTTGCTCAGCATGAAGCCGGAGTATA
ACCGGATGATAAAGACGGCCAACATGATGGCCCCCGCCGTTTTCATGAAG
CACGCAAGGAACAAGCTAATGAAAATGTTTGGGAACATCATTATGAGCAT
GAAGGACAGTAGTTTTTTTGGCCCCTTAGATGCTATAAGATTCCTGCTAT
CCGTTTTTTGCAAATGCTCGAAGTTTAAAAAATTGTGCGCCTTTATGTTC
ATATTGGCCAGTGAAGAACCAACATCGTATATGAACAATACCGCCATACC
ATTGATATTAGCAACGCATCCTGGTGCGATTTCCACTCGACAGCCAAAGC
ACTTTCTTCAACTCCGGAAATCTGGAAAATTCCGTCCGTATGACTTCGGA
GTCATGAGAAATAAAAAACTATACAATCAGGACACGCCTCCCGATTATCC
GTTGGAAAACGTCCGCCCTCAGTCGCCCATTCATATATACCACAGCCATG
GTGACGACTTGGTGGCGCGCAAAGACATCCACATACTGATCAGCAAGTTG
GACAAGGCGGTGTTGCATGACGTTGTTTTTGAAAAATGGAGCCACTCGGA
CTTTCTGTTCGCCAAATTAATCAAAAAAGTTGTTAATGAACCAATTATCA
AAGTTATTGATCACTTTGAGAATAGACAGCAATAGACATTTCTATTAGGA
ATGTAGGAATATTCTACATTAAATCATGGTATCTTTTTGCAAAGTCTTTA
CTTAAATAGTCTAAAATAAAAAACTATATATACAAAAAAAAAAAAAAAAA
AAAAA

MIP26281.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8462000..8462696 143..839 3485 100 Plus
chr3R 27901430 chr3R 8462750..8463242 840..1332 2465 100 Plus
chr3R 27901430 chr3R 8461805..8461946 2..143 710 100 Plus
chr3R 27901430 chr3R 8460595..8460756 441..602 285 78.4 Plus
chr3R 27901430 chr3R 8459043..8459203 443..603 265 77.6 Plus
chr3R 27901430 chr3R 8464304..8464455 447..598 235 77 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-RB 1221 CG11600-PB 1..1221 15..1235 6105 100 Plus
CG11598-RB 1167 CG11598-PB 361..522 441..602 285 78.4 Plus
CG18530-RA 1167 CG18530-PA 360..520 443..603 265 77.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-RB 1330 CG11600-RB 1..1330 2..1331 6650 100 Plus
CG11598-RB 1248 CG11598-RB 361..522 441..602 285 78.4 Plus
CG18530-RA 1188 CG18530-RA 363..523 443..603 265 77.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-PB 406 CG11600-PB 1..406 15..1232 2147 100 Plus
CG11608-PB 430 CG11608-PB 8..407 15..1220 1023 48.5 Plus
CG11598-PB 388 CG11598-PB 24..388 150..1244 988 49.3 Plus
CG18530-PA 389 CG18530-PA 19..380 135..1220 977 49.4 Plus
mag-PA 399 CG5932-PA 36..399 153..1226 681 38.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12636735..12637431 143..839 3485 100 Plus
3R 32079331 3R 12637485..12637977 840..1332 2465 100 Plus
3R 32079331 3R 12636540..12636681 2..143 710 100 Plus
3R 32079331 3R 12635332..12635493 441..602 285 78.4 Plus
3R 32079331 3R 12633781..12633941 443..603 265 77.6 Plus
3R 32079331 3R 12639039..12639190 447..598 220 76.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12377566..12378262 143..839 3485 100 Plus
3R 31820162 3R 12378316..12378808 840..1332 2465 100 Plus
3R 31820162 3R 12377371..12377512 2..143 710 100 Plus
3R 31820162 3R 12376163..12376324 441..602 285 78.3 Plus
3R 31820162 3R 12374612..12374772 443..603 265 77.6 Plus
3R 31820162 3R 12379870..12379915 447..492 170 91.3 Plus
Blast to na_te.dros performed on 2014-11-27 16:38:28 has no hits.

MIP26281.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:55:21 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8462750..8463218 840..1308 100 -> Plus
chr3R 8462001..8462696 144..839 100 -> Plus
chr3R 8461804..8461946 1..143 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-23 13:53:53 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RA 774..1113 896..1235 100   Plus
CG11600-RA 1..773 69..842 99 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:40:05 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 1..1221 15..1235 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:36:03 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 1..1221 15..1235 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:55:21 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 1..1221 15..1235 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-23 13:53:52 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RA 1..812 30..842 99 == Plus
CG11600-RA 813..1152 896..1235 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:40:05 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 1..1221 15..1235 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:36:03 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 1..1330 2..1331 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:55:21 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
CG11600-RB 1..1330 2..1331 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:55:21 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12637485..12637977 840..1333 99   Plus
3R 12636736..12637431 144..839 100 -> Plus
3R 12636539..12636681 1..143 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:36:03 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8463207..8463699 840..1333 99   Plus
arm_3R 8462458..8463153 144..839 100 -> Plus
arm_3R 8462261..8462403 1..143 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:19 Download gff for MIP26281.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12378316..12378808 840..1333 99   Plus
3R 12377567..12378262 144..839 100 -> Plus
3R 12377370..12377512 1..143 99 -> Plus

MIP26281.pep Sequence

Translation from 2 to 1234

> MIP26281.pep
NHCNMLLMELVIFFDWLLIVSGMPKVKFGLQNFTGRGKDYRIKVITGILI
IDKYGYSVETHTVRTGDGYILDMFRIPSSPNCKEDGFKPSVLIQHGLISL
ADSFLVTGPRSGLPFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWR
FSWHEMGMEDLPAMIDYILSTTNEEALHFVCHSQGCTTLLVLLSMKPEYN
RMIKTANMMAPAVFMKHARNKLMKMFGNIIMSMKDSSFFGPLDAIRFLLS
VFCKCSKFKKLCAFMFILASEEPTSYMNNTAIPLILATHPGAISTRQPKH
FLQLRKSGKFRPYDFGVMRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHG
DDLVARKDIHILISKLDKAVLHDVVFEKWSHSDFLFAKLIKKVVNEPIIK
VIDHFENRQQ*

MIP26281.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17111-PA 962 GF17111-PA 541..897 45..402 800 43.3 Plus
Dana\GF16783-PA 425 GF16783-PA 47..425 43..410 693 38.4 Plus
Dana\GF10345-PA 399 GF10345-PA 36..399 51..408 680 37.8 Plus
Dana\GF16784-PA 423 GF16784-PA 54..420 51..409 667 36.6 Plus
Dana\GF12624-PA 398 GF12624-PA 25..395 41..402 652 34.9 Plus
Dana\GF17111-PA 962 GF17111-PA 1..310 44..354 618 39.7 Plus
Dana\GF17111-PA 962 GF17111-PA 313..546 51..282 479 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19104-PA 386 GG19104-PA 16..384 24..410 1549 74.2 Plus
Dere\GG19093-PA 383 GG19093-PA 13..383 42..409 993 48.2 Plus
Dere\GG19115-PA 433 GG19115-PA 54..414 50..410 976 49 Plus
Dere\GG16116-PA 399 GG16116-PA 36..399 51..408 712 38.6 Plus
Dere\GG24941-PA 406 GG24941-PA 31..406 43..408 705 39.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10558-PA 402 GH10558-PA 30..401 43..407 718 39.8 Plus
Dgri\GH10557-PA 404 GH10557-PA 32..397 43..401 712 40.1 Plus
Dgri\GH23213-PA 422 GH23213-PA 48..418 43..406 701 39.1 Plus
Dgri\GH19443-PA 418 GH19443-PA 52..412 51..406 690 38.6 Plus
Dgri\GH19444-PA 424 GH19444-PA 56..418 51..406 683 38.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-PB 406 CG11600-PB 1..406 5..410 2147 100 Plus
CG11608-PB 430 CG11608-PB 8..407 5..406 1023 48.5 Plus
CG11598-PB 388 CG11598-PB 24..380 50..406 979 49.6 Plus
CG18530-PA 389 CG18530-PA 19..380 45..406 977 49.4 Plus
mag-PA 399 CG5932-PA 36..399 51..408 681 38.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24674-PA 420 GI24674-PA 56..418 51..406 731 40.6 Plus
Dmoj\GI16796-PA 408 GI16796-PA 33..396 43..399 713 40.3 Plus
Dmoj\GI13397-PA 401 GI13397-PA 35..401 51..408 689 38.2 Plus
Dmoj\GI20075-PA 407 GI20075-PA 31..398 50..406 665 36.8 Plus
Dmoj\GI20878-PA 399 GI20878-PA 26..398 41..404 659 36.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27144-PA 396 GL27144-PA 13..387 42..408 729 39.2 Plus
Dper\GL27143-PA 396 GL27143-PA 13..387 42..408 724 38.3 Plus
Dper\GL21801-PA 422 GL21801-PA 56..418 51..408 723 40.8 Plus
Dper\GL22025-PA 425 GL22025-PA 56..419 51..406 705 39.9 Plus
Dper\GL27145-PA 317 GL27145-PA 1..313 93..407 703 41.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11091-PA 378 GA11091-PA 14..374 46..407 795 41.6 Plus
Dpse\GA14975-PA 367 GA14975-PA 2..358 54..408 728 40.9 Plus
Dpse\GA22417-PA 363 GA22417-PA 2..357 54..407 720 40 Plus
Dpse\GA15999-PA 425 GA15999-PA 56..419 51..406 702 39.7 Plus
Dpse\GA17576-PA 470 GA17576-PA 84..461 39..406 699 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24050-PA 475 GM24050-PA 1..344 5..368 1586 82.4 Plus
Dsec\GM13607-PA 219 GM13607-PA 1..219 23..241 1110 92.7 Plus
Dsec\GM24052-PA 430 GM24052-PA 8..407 5..406 1044 48 Plus
Dsec\GM24047-PA 391 GM24047-PA 16..380 42..406 977 48.8 Plus
Dsec\GM24051-PA 210 GM24051-PA 1..194 5..198 974 92.3 Plus
Dsec\GM24050-PA 475 GM24050-PA 357..458 169..270 219 43.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18849-PA 370 GD18849-PA 1..370 23..408 1787 86.6 Plus
Dsim\GD18851-PA 435 GD18851-PA 56..412 50..406 1020 51 Plus
Dsim\GD18847-PA 391 GD18847-PA 19..380 45..406 987 49.2 Plus
Dsim\GD18848-PA 388 GD18848-PA 24..380 50..406 977 49.3 Plus
Dsim\GD14888-PA 399 GD14888-PA 36..399 51..408 698 38.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17195-PA 407 GJ17195-PA 38..402 51..406 720 39.8 Plus
Dvir\GJ23893-PA 424 GJ23893-PA 56..418 51..406 698 38.4 Plus
Dvir\GJ24675-PA 422 GJ24675-PA 58..419 51..406 672 38.5 Plus
Dvir\GJ11522-PA 401 GJ11522-PA 35..401 51..408 665 37.1 Plus
Dvir\GJ13469-PA 405 GJ13469-PA 31..396 50..406 658 37.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12869-PA 431 GK12869-PA 56..428 45..407 713 39.6 Plus
Dwil\GK12870-PA 427 GK12870-PA 54..419 51..406 695 37.9 Plus
Dwil\GK24189-PA 451 GK24189-PA 75..442 50..406 695 38.6 Plus
Dwil\GK12291-PA 406 GK12291-PA 45..406 51..406 690 38 Plus
Dwil\GK15530-PA 410 GK15530-PA 41..397 51..399 684 40.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26209-PA 387 GE26209-PA 1..383 8..408 1624 74.6 Plus
Dyak\GE26208-PA 388 GE26208-PA 13..381 42..407 995 48.8 Plus
Dyak\GE26210-PA 435 GE26210-PA 56..412 50..406 986 50.4 Plus
Dyak\GE19683-PA 399 GE19683-PA 36..399 51..408 703 38.5 Plus
Dyak\GE18232-PA 410 GE18232-PA 39..395 51..399 698 40.7 Plus

MIP26281.hyp Sequence

Translation from 2 to 1234

> MIP26281.hyp
NHCNMLLMELVIFFDWLLIVSGMPKVKFGLQNFTGRGKDYRIKVITGILI
IDKYGYSVETHTVRTGDGYILDMFRIPSSPNCKEDGFKPSVLIQHGLISL
ADSFLVTGPRSGLPFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWR
FSWHEMGMEDLPAMIDYILSTTNEEALHFVCHSQGCTTLLVLLSMKPEYN
RMIKTANMMAPAVFMKHARNKLMKMFGNIIMSMKDSSFFGPLDAIRFLLS
VFCKCSKFKKLCAFMFILASEEPTSYMNNTAIPLILATHPGAISTRQPKH
FLQLRKSGKFRPYDFGVMRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHG
DDLVARKDIHILISKLDKAVLHDVVFEKWSHSDFLFAKLIKKVVNEPIIK
VIDHFENRQQ*

MIP26281.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG11600-PB 406 CG11600-PB 1..406 5..410 2147 100 Plus
CG11608-PB 430 CG11608-PB 8..407 5..406 1023 48.5 Plus
CG11598-PB 388 CG11598-PB 24..380 50..406 979 49.6 Plus
CG18530-PA 389 CG18530-PA 19..380 45..406 977 49.4 Plus
mag-PA 399 CG5932-PA 36..399 51..408 681 38.3 Plus