Clone MIP26334 Report

Search the DGRC for MIP26334

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:263
Well:34
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14811-RB
Protein status:MIP26334.pep: gold
Sequenced Size:876

Clone Sequence Records

MIP26334.complete Sequence

876 bp assembled on 2010-08-20

GenBank Submission: BT125592.1

> MIP26334.complete
ATTACGATTGAGGACGACGACCAGTTAGTTCTATACCATATAGCTCTATA
ATCGGCAAATTGTGTTTTCCGTTACTTAAATAATCAAGACTGCGCCAAGT
CATAATGAAGCCAATAATGGAAACGAATATACAGGCATCCATTTGGAACA
AGAGATTCGAATCGACGATGATGAGTTCTTCCGAGCAAAGTTTTGCCAAG
TCCAATGGGACTAAAAAGAAGACTGTGACCTATTCACGTTTCATCCGCAC
CGAACGTGTCGCAGACGGACCGACCAATGCGGTGCAAAAGAAGACTGTGT
TCTTTTCGCGATTCGACCGCACCGCTCGCGCCGAAGAGGACCTAACCCGT
CAATTGGCCAGCGTGTCCTTAAAACCAAAACAGCCTGTGGCTTCCACCTC
GAATGAGCAGTTTTTTGCCAGCAACCTGCATTACTATCCCCATCTGCCCC
AGCCAACTGCGGTGGGCCACTACCAGACCTATGCCGAAATCAAGAGCCTC
TGGTTGAAGGGTCATTTCTCCCAAGCTTGTAACCCCACCTCGCGGTCGAT
GCAACCGCCTCGTCGTATTTCTATCACCAACGAGTTCCCGGATGATCAAC
CGAAGCCAGCTCCCAAACGCCGCTACTCGCTTGTCCGCCGCAACTCGATT
AACCTCCCAATTGGGTCCAATTTTGCTATGCCCGTGCTGATGGAGGAGGA
GAAGGAGGAGGATGAAGTGAAGGATCTAAATGAGAACAGCGGCTCCACCA
AGCCAGCTACATCGACCTCGAAAGGCGCAATCCCGAAGCAGCCCAAGAAG
TTCGCCTTAACCTTCTAGAAATGCTGTGACTAATAAATCTACCTAACTGA
AAAAAAAAAAAAAAAAAAAAAAAAAA

MIP26334.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1715340..1716043 849..146 3490 99.7 Minus
chrX 22417052 chrX 1716107..1716252 146..1 700 98.6 Minus
chrX 22417052 chrX 1713762..1713990 374..146 605 84.3 Minus
chrX 22417052 chrX 1713589..1713751 712..550 515 87.7 Minus
chrX 22417052 chrX 1714056..1714200 144..1 495 91 Minus
chrX 22417052 chrX 1713383..1713529 849..703 435 86.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-RB 714 CG14811-PB 1..714 105..818 3570 100 Plus
CG14810-RB 606 CG14810-PB 1..258 117..374 690 84.5 Plus
CG14810-RA 609 CG14810-PA 1..261 117..374 625 83.5 Plus
CG14810-RB 606 CG14810-PB 269..431 550..712 530 88.3 Plus
CG14810-RB 606 CG14810-PB 491..606 703..818 370 87.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-RB 849 CG14811-RB 1..849 1..849 4230 99.9 Plus
CG14810-RB 717 CG14810-RB 36..321 89..374 770 84.6 Plus
CG14810-RA 720 CG14810-RA 36..324 89..374 705 83.7 Plus
CG14810-RB 717 CG14810-RB 332..494 550..712 530 88.3 Plus
CG14810-RB 717 CG14810-RB 554..700 703..849 435 86.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-PB 237 CG14811-PB 1..237 105..815 1120 100 Plus
CG14810-PB 201 CG14810-PB 1..201 117..815 432 48.8 Plus
CG14810-PA 202 CG14810-PA 1..202 117..815 420 48.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1821469..1822172 849..146 3520 100 Minus
X 23542271 X 1822236..1822381 146..1 715 99.3 Minus
X 23542271 X 1819891..1820119 374..146 605 84.3 Minus
X 23542271 X 1819718..1819880 712..550 530 88.3 Minus
X 23542271 X 1820185..1820329 144..1 465 89.7 Minus
X 23542271 X 1819511..1819658 850..703 440 86.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1829567..1830270 849..146 3520 100 Minus
X 23527363 X 1830334..1830479 146..1 715 99.3 Minus
X 23527363 X 1827989..1828217 374..146 605 84.2 Minus
X 23527363 X 1827816..1827978 712..550 530 88.3 Minus
X 23527363 X 1828283..1828427 144..1 475 89.6 Minus
X 23527363 X 1827609..1827756 850..703 440 86.4 Minus
Blast to na_te.dros performed on 2014-11-27 08:52:36 has no hits.

MIP26334.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:10:09 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1716107..1716252 1..146 98   Minus
chrX 1715340..1716042 147..849 95 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:07:01 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RA 1..651 168..818 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:48 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RA 1..651 168..818 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:36:43 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RB 1..714 105..818 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:10:09 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RB 1..714 105..818 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:07:01 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RA 1..651 168..818 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:48 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RA 1..651 168..818 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:36:43 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RB 1..849 1..849 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:10:09 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
CG14811-RB 1..849 1..849 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:10:09 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
X 1822236..1822381 1..146 99   Minus
X 1821469..1822171 147..849 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:36:43 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1716269..1716414 1..146 99   Minus
arm_X 1715502..1716204 147..849 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:59 Download gff for MIP26334.complete
Subject Subject Range Query Range Percent Splice Strand
X 1830334..1830479 1..146 99   Minus
X 1829567..1830269 147..849 100 <- Minus

MIP26334.pep Sequence

Translation from 104 to 817

> MIP26334.pep
MKPIMETNIQASIWNKRFESTMMSSSEQSFAKSNGTKKKTVTYSRFIRTE
RVADGPTNAVQKKTVFFSRFDRTARAEEDLTRQLASVSLKPKQPVASTSN
EQFFASNLHYYPHLPQPTAVGHYQTYAEIKSLWLKGHFSQACNPTSRSMQ
PPRRISITNEFPDDQPKPAPKRRYSLVRRNSINLPIGSNFAMPVLMEEEK
EEDEVKDLNENSGSTKPATSTSKGAIPKQPKKFALTF*

MIP26334.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21079-PA 386 GF21079-PA 105..159 99..153 147 56.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12681-PA 227 GG12681-PA 1..222 1..237 478 47.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-PB 237 CG14811-PB 1..237 1..237 1228 100 Plus
CG14810-PB 201 CG14810-PB 1..201 5..237 499 48.4 Plus
CG14810-PA 202 CG14810-PA 1..202 5..237 487 48.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18953-PA 479 GM18953-PA 108..278 10..196 433 56.4 Plus
Dsec\GM18953-PA 479 GM18953-PA 1..109 1..117 380 69.2 Plus
Dsec\GM18953-PA 479 GM18953-PA 302..479 15..237 337 45 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16412-PA 225 GD16412-PA 1..225 1..237 835 72.6 Plus
Dsim\GD16413-PA 177 GD16413-PA 1..177 1..237 363 44.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16510-PA 241 GE16510-PA 1..236 1..237 504 47.4 Plus

MIP26334.hyp Sequence

Translation from 104 to 817

> MIP26334.hyp
MKPIMETNIQASIWNKRFESTMMSSSEQSFAKSNGTKKKTVTYSRFIRTE
RVADGPTNAVQKKTVFFSRFDRTARAEEDLTRQLASVSLKPKQPVASTSN
EQFFASNLHYYPHLPQPTAVGHYQTYAEIKSLWLKGHFSQACNPTSRSMQ
PPRRISITNEFPDDQPKPAPKRRYSLVRRNSINLPIGSNFAMPVLMEEEK
EEDEVKDLNENSGSTKPATSTSKGAIPKQPKKFALTF*

MIP26334.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG14811-PB 237 CG14811-PB 1..237 1..237 1228 100 Plus
CG14810-PB 201 CG14810-PB 1..201 5..237 499 48.4 Plus
CG14810-PA 202 CG14810-PA 1..202 5..237 487 48.2 Plus