Clone MIP26355 Report

Search the DGRC for MIP26355

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:263
Well:55
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG30401-RA
Protein status:MIP26355.pep: gold
Sequenced Size:1156

Clone Sequence Records

MIP26355.complete Sequence

1156 bp assembled on 2010-08-20

GenBank Submission: BT125589.1

> MIP26355.complete
CCTGTCAAACAAATCATCGTGTCGAGCTGAGCAGAACGTCCGGAATACGA
CAACGCGAGTGAAATTGTGTAAATCTCTAGACCCAAAAACCAATCGAAAG
TTCTTCACTGCTTTCTTCTCGCTTCTTTGCTTGGTTAGGATACTCGATTA
TCGATATTGGAGTTACTCTAAAATGGAAAGATTTGGTATTCCACGTGGTA
AGCGTCCCCGAGTCCAAGTTTCATTGGACGACAAGGAGCGAGCCATAGCC
CGAATCCGAGGTGGTGAAACCAAGGCCGGAATATCACGCGAATTGGGTGT
TCCGGAGTCTACGGTTCGCGGTTGGGTGAAACGAGCTGAGCAGCGGTTGG
CCCGAGAGACAACTAGCCAAACGGGTTCTGCCAACTATTCCACAATCCTG
GCCATGACCCTAGCGAAACCGCAAGTTACCATCAGCACAAAATCGTCGGC
TTCGTCTGTCATTTCTAAATCATCATACTCATCGCCACCGCTGGATTTGA
AACCCCTGAAACAGCCCCAGAAACGAAACATTAATGGTCATCCGGTAACG
TGCACCCAGGATCCAGTCGAGGATTCAGCAGCTACATCCATCCCCATCCC
CGTTCCGATTCCGGTGCCCCTTCCTGTGCCGCCAATGGTTTCGCCTGACA
GTGAGCAACAGATGAGCGCTTGGTTGCATATATTCAATGCGGGAATTCTG
AACTTCACTCTGATTGCCTCCGCTGCAGTGCTTCAGGCTCGCTCGCGTGG
TTTGGCGGATCGCCTGCCGTTGTGGCAAATTATCACGGATTTTGTTGATG
AAGCCGAACGTAATGTGAATGCCAACGGGGGTTGGTACCTCGAGGGACAG
CCGGCGACAGGACACATGAGTGCCAGGCAACGGCCAGTCCGAGTGCCCAC
GAAGGTGCATTCATATCGCAGGAACTTGAAGGCACCACCGGCTCATATTA
CCGCCGAAGATGACGAAGACTCCTACACGGACGCTGATGTGCCACACTGA
TCTCACATGGAATGCTCTGGGAGCCCACTCTCTGGAGAAGAAGTATTAAT
AGAGGCTATTAGCATATACATACATAAGATATTGTTACGTTTTTTAAAAT
CAGAATAAATACTCTCAGCATGAAAGTATTCCAAATAAAAAAAAAAAAAA
AAAAAA

MIP26355.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17872009..17872778 1136..367 3760 99.2 Minus
chr2R 21145070 chr2R 17872824..17873199 376..1 1805 98.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-RC 828 CG30401-PC 1..828 173..1000 4140 100 Plus
CG30401-RA 828 CG30401-PA 1..828 173..1000 4140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-RA 1258 CG30401-RA 123..1258 1..1136 5680 100 Plus
CG30401-RC 1188 CG30401-RC 191..1188 139..1136 4990 100 Plus
CG30401-RC 1188 CG30401-RC 123..191 1..69 345 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-PC 275 CG30401-PC 1..275 173..997 1128 100 Plus
CG30401-PA 275 CG30401-PA 1..275 173..997 1128 100 Plus
danr-PA 419 CG13651-PA 16..66 194..349 156 61.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21985623..21986395 1139..367 3850 99.9 Minus
2R 25286936 2R 21986441..21986816 376..1 1880 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21986822..21987594 1139..367 3850 99.8 Minus
2R 25260384 2R 21987640..21988015 376..1 1880 100 Minus
Blast to na_te.dros performed on 2014-11-27 04:01:49 has no hits.

MIP26355.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:05:40 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17872826..17873199 1..374 98   Minus
chr2R 17872009..17872770 375..1136 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:06:57 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..828 173..1000 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:43 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..828 173..1000 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:38 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..828 173..1000 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:40 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..828 173..1000 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:06:56 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..828 173..1000 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:43 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..828 173..1000 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:38 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:40 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
CG30401-RA 123..1258 1..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:05:40 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21986443..21986816 1..374 100   Minus
2R 21985626..21986387 375..1136 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:38 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17873948..17874321 1..374 100   Minus
arm_2R 17873131..17873892 375..1136 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:54 Download gff for MIP26355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21987642..21988015 1..374 100   Minus
2R 21986825..21987586 375..1136 100 <- Minus

MIP26355.hyp Sequence

Translation from 0 to 999

> MIP26355.hyp
LSNKSSCRAEQNVRNTTTRVKLCKSLDPKTNRKFFTAFFSLLCLVRILDY
RYWSYSKMERFGIPRGKRPRVQVSLDDKERAIARIRGGETKAGISRELGV
PESTVRGWVKRAEQRLARETTSQTGSANYSTILAMTLAKPQVTISTKSSA
SSVISKSSYSSPPLDLKPLKQPQKRNINGHPVTCTQDPVEDSAATSIPIP
VPIPVPLPVPPMVSPDSEQQMSAWLHIFNAGILNFTLIASAAVLQARSRG
LADRLPLWQIITDFVDEAERNVNANGGWYLEGQPATGHMSARQRPVRVPT
KVHSYRRNLKAPPAHITAEDDEDSYTDADVPH*

MIP26355.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-PC 275 CG30401-PC 1..275 58..332 1418 100 Plus
CG30401-PA 275 CG30401-PA 1..275 58..332 1418 100 Plus
danr-PA 419 CG13651-PA 16..66 65..116 156 61.5 Plus

MIP26355.pep Sequence

Translation from 1 to 999

> MIP26355.pep
LSNKSSCRAEQNVRNTTTRVKLCKSLDPKTNRKFFTAFFSLLCLVRILDY
RYWSYSKMERFGIPRGKRPRVQVSLDDKERAIARIRGGETKAGISRELGV
PESTVRGWVKRAEQRLARETTSQTGSANYSTILAMTLAKPQVTISTKSSA
SSVISKSSYSSPPLDLKPLKQPQKRNINGHPVTCTQDPVEDSAATSIPIP
VPIPVPLPVPPMVSPDSEQQMSAWLHIFNAGILNFTLIASAAVLQARSRG
LADRLPLWQIITDFVDEAERNVNANGGWYLEGQPATGHMSARQRPVRVPT
KVHSYRRNLKAPPAHITAEDDEDSYTDADVPH*

MIP26355.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11604-PA 273 GF11604-PA 1..271 58..330 742 58.9 Plus
Dana\GF17893-PA 420 GF17893-PA 16..66 65..116 163 61.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20731-PA 264 GG20731-PA 1..264 58..324 1047 85.4 Plus
Dere\GG11367-PA 419 GG11367-PA 16..66 65..116 164 61.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21351-PA 214 GH21351-PA 1..169 58..277 470 49.1 Plus
Dgri\GH18050-PA 412 GH18050-PA 5..66 54..116 164 54 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30401-PC 275 CG30401-PC 1..275 58..332 1418 100 Plus
CG30401-PA 275 CG30401-PA 1..275 58..332 1418 100 Plus
danr-PA 419 CG13651-PA 16..66 65..116 156 61.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20766-PA 247 GI20766-PA 1..241 58..324 536 46.9 Plus
Dmoj\GI23730-PA 430 GI23730-PA 16..77 65..128 170 57.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17502-PA 251 GL17502-PA 1..224 58..286 500 44.7 Plus
Dper\GL21906-PA 429 GL21906-PA 5..66 54..116 170 55.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30448-PA 251 GA30448-PA 1..224 58..286 487 42.8 Plus
Dpse\GA12437-PA 432 GA12437-PA 5..66 54..116 170 55.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15675-PA 112 GM15675-PA 1..111 221..331 569 94.6 Plus
Dsec\GM15674-PA 158 GM15674-PA 1..129 58..186 545 93 Plus
Dsec\GM19439-PA 97 GM19439-PA 46..97 1..52 249 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25155-PA 275 GD25155-PA 1..275 58..332 1171 93.1 Plus
Dsim\GD21179-PA 495 GD21179-PA 92..142 65..116 164 61.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20502-PA 131 GJ20502-PA 1..127 201..329 297 50.8 Plus
Dvir\GJ17111-PA 101 GJ17111-PA 1..80 58..137 288 72.5 Plus
Dvir\GJ23601-PA 418 GJ23601-PA 5..77 54..128 171 52 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15635-PA 215 GK15635-PA 1..62 58..119 298 90.3 Plus
Dwil\GK13890-PA 443 GK13890-PA 16..66 65..116 164 61.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13663-PA 276 GE13663-PA 1..276 58..332 1026 87 Plus
Dyak\GE23564-PA 422 GE23564-PA 16..66 65..116 165 61.5 Plus