Clone MIP27352 Report

Search the DGRC for MIP27352

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:273
Well:52
Vector:pOT2a
Associated Gene/TranscriptCG10237-RC
Protein status:MIP27352.pep: gold
Sequenced Size:2016

Clone Sequence Records

MIP27352.complete Sequence

2016 bp assembled on 2010-10-29

GenBank Submission: BT125736.1

> MIP27352.complete
CTGGGCTTTCAGCTCCGTTGCACGCGTCACTCGCAGCTGGTTTTTTGGGC
CGTCTTTGCGGAATACTGTTAGCCATTATACCATTATAGCCTTTAAGTTT
GGGCCAAACTAGTTTCGGTCGTGTTGTGTTGTCTTGTGTTGTGTTGTGAT
CCGTGTGTACTATTTAAGATCTCGTATTTTCCCAGACACAACATCAGCGA
TTCAGTAGACTCTTGTGTATCATTCATGAATGCAAAAACAGACGATACCC
TAAGCAAATCACCTGGCCCATCTAGCCGAAATTGGTAGCAATTTTCAATG
TCAGCGCTTCGGATGCTAATCTCCTAGTCTTTTGTTTCGAGCCAGCACTA
ACGCTAATTTTCGATTTGATGGGAAATCTTCAGCGCTAATTTCCGATTTG
ATGGGAAATCTAGTGTGCTAATTTCTGATATCCAACTGCCCCACTATATA
AGCTCACAGACCCTGGCTCCTCATCTCGCAATTCGAAACCTGCCTAACTG
GAAATTACGCTCAAGTAGAACGCGTCAAGTGTCTCCAGAATTTAGTTCAA
GGCTCCTAACGTTATTTTCTGATCTCTGAAGAATTGCATTATCTTCGCGA
ATCTCTGGCCTCTTCTTCCGTTTTAAGCAATTTGCGAATGTCAAGGTGAA
GGTCGGCCAGAGGGCACAATTTTACATTTGGCAAACTGAAAATATACAGC
GGCGAACCGCTTAGAAAAAGCACATAGCTTAATATAATCGCAGAATAATT
TCAGTTCAGCCAGAGCAGCAACAATTGCAAAATGAGAGTACCCACCATGC
TGTCGGACATCGACCAACTGCCCACGCTCCAGGTGGGCGACTACACGCTC
CAGTTCGAGTTGGGCGAGCCGACTGCCCAGGGCAAGGAGGTGGCCATCAA
GGAGCTGCGCGAAACACCCGAGCGCCAGAAGGAGGCCTCCAAGGAGCTGG
CCCGTCTTCTAGAAGCGGAGACGGACTTGCTGTACCCCAAGGGAAACGAG
GAGTGGCTGATCAGATACCTGCGGCCCTGCAAGTATTACCCGGAAAGTGC
CCGTGATCTGATTAAGCGGTACTACGCCTTCAAGGTGAAGCACGCGGATG
TGTACACCGACCTGAAGCCATCGAACGAGGCCAACATCTTCAAGCACAAC
ATCCTTACCGTCTTCCCCAACCGAGATCAACTGGGTCGTCGCATTTTGGT
CCTCGAACTGGGCAAGCGCTGGAAGCACAAGCAGGTCACCCTCGATGAGG
TGTTCAAGGGAGCTGTGCTCTTCCTGGAGGCGGCCATGCTGGAGCCAGAA
ACACAGATCTGCGGAGCCGTTGTGATCTTCGACATGGATGGCCTCAGTCT
CCAGCAAACGTGGCAGTTTACGCCTCCGTTCGCCAAGCGCATTGTGGACT
GGCTTCAGGACTCGGTGCCGCTCCGGATCAAGGCCATTCACATCGTGAAC
CAGCCGAAGATTTTCCAGGTGGTCTTTGCCCTGTTCAAGCCCTTCCTCAA
GGAGAAGCTGCGCAGCAGGATCATCTTCCATGGCACCGATCGCGAGTCCC
TGCACAAATACATGTCGCCCAAGTGCCTGCCAGCCGCCTACGGAGGATTC
CGGGAGGCCAGCCGCATCGACAGCGACCAGTGGTACCAGCTGCTGCTCAA
GTGCGACACCGAGTTCGACACCATCAACTCGTACGGCTACAAGAAGAAGT
GATCTGTGGCCACCGGCCTGGTGCTGCTCGTGATAATCAACTCCACTCGT
TTCCACACGTCTTCACATTAAGCCCACGTGGAGCGTTATAGTTAAGCACT
CGATCTACCATACGCTTGTCCTGTTAGTGAGTAGCGCCTAGAGTTTGCCT
TAGTCTTAACCAGGATCGGAGTGTCGATCGCAGCCAGAAGAAGTGTTATA
CCTACATGCATATTATTTTAATCCGGGGTAAGCGTATTTATATCATTTTA
CTATTGTACATTAAACCAATTGTTAAAATATAAACATACTTTGTAAACAA
AAAAAAAAAAAAAAAA

MIP27352.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:02:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19434408..19435191 1998..1215 3890 99.7 Minus
chr2L 23010047 chr2L 19436852..19437511 660..1 3270 99.7 Minus
chr2L 23010047 chr2L 19436224..19436403 965..786 900 100 Minus
chr2L 23010047 chr2L 19435368..19435522 1214..1060 775 100 Minus
chr2L 23010047 chr2L 19436566..19436693 786..659 640 100 Minus
chr2L 23010047 chr2L 19435590..19435686 1060..964 485 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-RE 921 CG10237-PE 1..921 782..1702 4605 100 Plus
CG10237-RC 921 CG10237-PC 1..921 782..1702 4605 100 Plus
CG10237-RB 975 CG10237-PB 59..975 786..1702 4585 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-RE 2011 CG10237-RE 14..2011 1..1998 9990 100 Plus
CG10237-RC 1418 CG10237-RC 81..1418 661..1998 6690 100 Plus
CG10237-RD 1720 CG10237-RD 508..1720 786..1998 6065 100 Plus
CG10237-RC 1418 CG10237-RC 14..80 1..67 335 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-PE 306 CG10237-PE 1..306 782..1699 1606 100 Plus
CG10237-PC 306 CG10237-PC 1..306 782..1699 1606 100 Plus
CG10237-PB 324 CG10237-PB 21..324 788..1699 1596 100 Plus
CG10237-PD 301 CG10237-PD 1..301 797..1699 1580 100 Plus
CG10237-PA 301 CG10237-PA 1..301 797..1699 1580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19435847..19436633 2001..1215 3935 100 Minus
2L 23513712 2L 19438294..19438953 660..1 3300 100 Minus
2L 23513712 2L 19437666..19437845 965..786 900 100 Minus
2L 23513712 2L 19436810..19436964 1214..1060 775 100 Minus
2L 23513712 2L 19438008..19438135 786..659 640 100 Minus
2L 23513712 2L 19437032..19437128 1060..964 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19435847..19436633 2001..1215 3935 100 Minus
2L 23513712 2L 19438294..19438953 660..1 3300 100 Minus
2L 23513712 2L 19437666..19437845 965..786 900 100 Minus
2L 23513712 2L 19436810..19436964 1214..1060 775 100 Minus
2L 23513712 2L 19438008..19438135 786..659 640 100 Minus
2L 23513712 2L 19437032..19437128 1060..964 485 100 Minus
Blast to na_te.dros performed 2014-11-27 16:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
flea 5034 flea DMBLPP 5034bp Derived from Z27119 (g415797) (Rel. 50, Last updated, Version 6). 4329..4389 1648..1707 122 68.9 Plus

MIP27352.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:42:17 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19436852..19437511 1..660 95   Minus
chr2L 19436567..19436691 661..785 100 <- Minus
chr2L 19436224..19436403 786..965 100 <- Minus
chr2L 19435590..19435684 966..1060 100 <- Minus
chr2L 19435368..19435521 1061..1214 100 <- Minus
chr2L 19434408..19435191 1215..1998 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-10-29 13:22:19 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 1..921 782..1702 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:43:20 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 1..921 782..1702 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:20:56 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 1..921 782..1702 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:42:17 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 1..921 782..1702 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-29 13:22:18 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 79..1416 661..1998 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:43:19 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RC 79..1416 661..1998 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:20:56 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RE 14..2011 1..1998 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:42:17 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
CG10237-RE 14..2011 1..1998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:42:17 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19438294..19438953 1..660 100   Minus
2L 19438009..19438133 661..785 100 <- Minus
2L 19437666..19437845 786..965 100 <- Minus
2L 19437032..19437126 966..1060 100 <- Minus
2L 19436810..19436963 1061..1214 100 <- Minus
2L 19435850..19436633 1215..1998 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:20:56 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19438294..19438953 1..660 100   Minus
arm_2L 19438009..19438133 661..785 100 <- Minus
arm_2L 19437666..19437845 786..965 100 <- Minus
arm_2L 19437032..19437126 966..1060 100 <- Minus
arm_2L 19436810..19436963 1061..1214 100 <- Minus
arm_2L 19435850..19436633 1215..1998 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:50:22 Download gff for MIP27352.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19438294..19438953 1..660 100   Minus
2L 19438009..19438133 661..785 100 <- Minus
2L 19437666..19437845 786..965 100 <- Minus
2L 19437032..19437126 966..1060 100 <- Minus
2L 19436810..19436963 1061..1214 100 <- Minus
2L 19435850..19436633 1215..1998 100 <- Minus

MIP27352.pep Sequence

Translation from 781 to 1701

> MIP27352.pep
MRVPTMLSDIDQLPTLQVGDYTLQFELGEPTAQGKEVAIKELRETPERQK
EASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPESARDLIKRYYAF
KVKHADVYTDLKPSNEANIFKHNILTVFPNRDQLGRRILVLELGKRWKHK
QVTLDEVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPPF
AKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFH
GTDRESLHKYMSPKCLPAAYGGFREASRIDSDQWYQLLLKCDTEFDTINS
YGYKKK*

MIP27352.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15843-PA 306 GF15843-PA 1..306 1..306 1499 90.2 Plus
Dana\GF15861-PA 311 GF15861-PA 10..303 9..303 604 41.6 Plus
Dana\GF14025-PA 294 GF14025-PA 6..278 18..290 503 39.4 Plus
Dana\GF14236-PA 290 GF14236-PA 54..258 70..275 394 35.4 Plus
Dana\GF24441-PA 310 GF24441-PA 12..285 35..306 259 25 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21633-PA 329 GG21633-PA 26..329 3..306 1584 97 Plus
Dere\GG10481-PA 311 GG10481-PA 10..303 9..303 594 41.2 Plus
Dere\GG23533-PA 294 GG23533-PA 6..276 18..288 490 38.2 Plus
Dere\GG21183-PA 292 GG21183-PA 24..258 40..275 404 33.5 Plus
Dere\GG15223-PA 311 GG15223-PA 9..252 31..272 282 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 15:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13468-PA 301 GH13468-PA 1..301 6..306 1407 86 Plus
Dgri\GH13736-PA 312 GH13736-PA 10..303 9..303 604 41.7 Plus
Dgri\GH13145-PA 294 GH13145-PA 7..287 19..302 485 37.2 Plus
Dgri\GH11102-PA 290 GH11102-PA 54..258 70..275 409 36.9 Plus
Dgri\GH15439-PA 324 GH15439-PA 23..265 32..272 261 27.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-PE 306 CG10237-PE 1..306 1..306 1606 100 Plus
CG10237-PC 306 CG10237-PC 1..306 1..306 1606 100 Plus
CG10237-PB 324 CG10237-PB 21..324 3..306 1596 100 Plus
CG10237-PD 301 CG10237-PD 1..301 6..306 1580 100 Plus
CG10237-PA 301 CG10237-PA 1..301 6..306 1580 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 15:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17220-PA 306 GI17220-PA 1..306 1..306 1416 84.3 Plus
Dmoj\GI23782-PA 312 GI23782-PA 10..272 9..272 598 43.9 Plus
Dmoj\GI17784-PA 294 GI17784-PA 1..287 13..302 504 36.4 Plus
Dmoj\GI18224-PA 290 GI18224-PA 28..258 44..275 419 35.3 Plus
Dmoj\GI16717-PA 308 GI16717-PA 9..280 31..297 268 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21107-PA 337 GL21107-PA 34..337 3..306 1476 89.1 Plus
Dper\GL25934-PA 294 GL25934-PA 6..278 18..290 497 38.3 Plus
Dper\GL25817-PA 331 GL25817-PA 10..323 9..303 490 34.8 Plus
Dper\GL21211-PA 340 GL21211-PA 74..308 40..275 408 33.9 Plus
Dper\GL16163-PA 311 GL16163-PA 16..282 38..302 271 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10180-PA 337 GA10180-PA 34..337 3..306 1476 89.1 Plus
Dpse\GA19271-PA 311 GA19271-PA 10..303 9..303 595 41.2 Plus
Dpse\GA19258-PA 294 GA19258-PA 6..278 18..290 497 38.3 Plus
Dpse\GA10016-PA 290 GA10016-PA 24..258 40..275 406 33.9 Plus
Dpse\GA28411-PA 311 GA28411-PA 16..282 38..302 271 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17010-PA 324 GM17010-PA 19..324 1..306 1615 98.4 Plus
Dsec\GM16464-PA 311 GM16464-PA 10..303 9..303 592 41.2 Plus
Dsec\GM13560-PA 294 GM13560-PA 6..272 18..284 486 38.8 Plus
Dsec\GM17350-PA 303 GM17350-PA 1..271 1..275 403 31.5 Plus
Dsec\GM14655-PA 311 GM14655-PA 9..252 31..272 278 30.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21760-PA 321 GD21760-PA 16..321 1..306 1611 98.7 Plus
Dsim\GD23473-PA 311 GD23473-PA 10..303 9..303 594 41.2 Plus
Dsim\GD22495-PA 294 GD22495-PA 6..276 18..288 492 38.6 Plus
Dsim\GD24208-PA 290 GD24208-PA 24..258 40..275 401 33.1 Plus
Dsim\GD13840-PA 311 GD13840-PA 9..252 31..272 286 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 15:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17977-PA 306 GJ17977-PA 1..306 1..306 1403 84 Plus
Dvir\GJ20969-PA 312 GJ20969-PA 39..303 38..303 574 43.1 Plus
Dvir\GJ17610-PA 294 GJ17610-PA 1..276 13..288 509 39 Plus
Dvir\GJ18131-PA 290 GJ18131-PA 19..258 42..275 419 35.7 Plus
Dvir\GJ12461-PA 308 GJ12461-PA 4..271 26..301 267 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 15:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18196-PA 306 GK18196-PA 1..306 1..306 1461 87.9 Plus
Dwil\GK24307-PA 312 GK24307-PA 10..303 9..303 595 41.2 Plus
Dwil\GK24724-PA 292 GK24724-PA 4..276 18..290 506 39.4 Plus
Dwil\GK24799-PA 290 GK24799-PA 24..258 40..275 410 33.1 Plus
Dwil\GK11682-PA 311 GK11682-PA 9..286 45..300 284 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12652-PA 329 GE12652-PA 26..329 3..306 1620 99.7 Plus
Dyak\GE14561-PA 311 GE14561-PA 10..303 9..303 591 40.9 Plus
Dyak\GE18359-PA 294 GE18359-PA 6..278 18..290 491 38.7 Plus
Dyak\GE13256-PA 291 GE13256-PA 24..257 40..275 395 33.9 Plus
Dyak\GE21443-PA 311 GE21443-PA 9..252 31..272 296 30.9 Plus

MIP27352.hyp Sequence

Translation from 781 to 1701

> MIP27352.hyp
MRVPTMLSDIDQLPTLQVGDYTLQFELGEPTAQGKEVAIKELRETPERQK
EASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPESARDLIKRYYAF
KVKHADVYTDLKPSNEANIFKHNILTVFPNRDQLGRRILVLELGKRWKHK
QVTLDEVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPPF
AKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFH
GTDRESLHKYMSPKCLPAAYGGFREASRIDSDQWYQLLLKCDTEFDTINS
YGYKKK*

MIP27352.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG10237-PE 306 CG10237-PE 1..306 1..306 1606 100 Plus
CG10237-PC 306 CG10237-PC 1..306 1..306 1606 100 Plus
CG10237-PB 324 CG10237-PB 21..324 3..306 1596 100 Plus
CG10237-PD 301 CG10237-PD 1..301 6..306 1580 100 Plus
CG10237-PA 301 CG10237-PA 1..301 6..306 1580 100 Plus