Clone MIP29201 Report

Search the DGRC for MIP29201

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:292
Well:1
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42688-RA
Protein status:MIP29201.pep: gold
Sequenced Size:543

Clone Sequence Records

MIP29201.complete Sequence

543 bp assembled on 2011-03-01

GenBank Submission: BT126110.1

> MIP29201.complete
AACACATCTAAAGTAACACAGGAACAGGAATCCCAATGACCAACACCTTT
TGGAAATAAATTTCTTGTCGTGACAATATTCTCGTTTCGGTTCTCGAGTG
AGTGCGTATCCGTGATCCTTGTTTACTTTGTGGATTCTCTCCATCCATTG
ACTTCCACCCAAATATCCTAATCCTATCCAAGATGTGCTGCAATCCTGGA
GGCTGCTGCAACCTGCCCTCCTGCATCCAGTGCACCAACTTTTGTTTCAA
CTGCTGGACGGGAACTGCTGCAGTGCCATGTTGCCGAGGTAGTTGCATTC
CGGGATGCAGTAGCAGCCCTGGATGCCGTTGCTGATTATCACCAAAATTA
TTACACAAGTCTACAACTAAAAACTGAAATAAACTAACAGATACCCCAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP29201.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 17:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19180763..19181088 397..72 1615 99.7 Minus
chr2L 23010047 chr2L 19181149..19181220 72..1 360 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-RB 153 CG42688-PB 1..153 183..335 765 100 Plus
CG42688-RA 153 CG42688-PA 1..153 183..335 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-RB 785 CG42688-RB 163..559 1..397 1985 100 Plus
CG42688-RA 397 CG42688-RA 1..397 1..397 1985 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-PB 50 CG42688-PB 1..31 183..275 200 100 Plus
CG42688-PA 50 CG42688-PA 1..31 183..275 200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19182188..19182516 400..72 1645 100 Minus
2L 23513712 2L 19182577..19182648 72..1 360 100 Minus
2R 25286936 2R 513547..513586 437..398 200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19182188..19182516 400..72 1645 100 Minus
2L 23513712 2L 19182577..19182648 72..1 360 100 Minus
Blast to na_te.dros performed on 2014-11-27 17:23:42 has no hits.

MIP29201.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:10:53 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19181149..19181220 1..72 100   Minus
chr2L 19180763..19181087 73..397 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 11:11:36 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 1..153 183..335 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:26 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 1..153 183..335 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:53 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 1..153 183..335 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 11:11:35 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 12..408 1..397 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:26 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 1..397 1..397 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:53 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
CG42688-RA 1..397 1..397 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:10:53 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19182577..19182648 1..72 100   Minus
2L 19182191..19182515 73..397 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:26 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19182577..19182648 1..72 100   Minus
arm_2L 19182191..19182515 73..397 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:31 Download gff for MIP29201.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19182577..19182648 1..72 100   Minus
2L 19182191..19182515 73..397 100 <- Minus

MIP29201.pep Sequence

Translation from 182 to 334

> MIP29201.pep
MCCNPGGCCNLPSCIQCTNFCFNCWTGTAAVPCCRGSCIPGCSSSPGCRC
*

MIP29201.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-PB 50 CG42688-PB 1..50 1..50 323 100 Plus
CG42688-PA 50 CG42688-PA 1..50 1..50 323 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21123-PA 119 GL21123-PA 64..105 1..42 164 76.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29078-PA 117 GA29078-PA 62..103 1..42 165 76.2 Plus
Dpse\GA28761-PA 119 GA28761-PA 64..105 1..42 164 76.2 Plus

MIP29201.hyp Sequence

Translation from 182 to 334

> MIP29201.hyp
MCCNPGGCCNLPSCIQCTNFCFNCWTGTAAVPCCRGSCIPGCSSSPGCRC
*

MIP29201.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42688-PB 50 CG42688-PB 1..50 1..50 323 100 Plus
CG42688-PA 50 CG42688-PA 1..50 1..50 323 100 Plus