Clone MIP29328 Report

Search the DGRC for MIP29328

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:293
Well:28
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42554-RA
Protein status:MIP29328.pep: gold
Sequenced Size:1046

Clone Sequence Records

MIP29328.complete Sequence

1046 bp assembled on 2011-03-01

GenBank Submission: BT126114.1

> MIP29328.complete
TTTGGAAACTGCGTTCTTGCAAAAAAATAGACGACATTTTGCTTGCATAA
AACAGGCAATATTGCAATTGGGAATATAATTATTAAAATTTAGGTGCCTG
GCAATTTCAACGTTACAAGAGCAATCATATAATTTCAAATCAGGACGGGA
AAACAGTCAAAAACATGGACTGCGCACCACTGAACTTGGCTCATTTCCAC
GAGCGAAGGTCGGAGCGATTTATACGCAATCACCGCTATGAGGAGGCCAT
TAAAGCGCTGGAAACATCCCTAATCTACATGCAGGATGCCCAAAAACGGG
TGGCTCTGCCCAAATCCAAGGAAGTTCTGGACACATTGACCCTCGATTTT
CAGCGCAAACTGCGTCAAATTGAGATGCGAAAGACGCAGCATGGTCTGAA
CAAGCTGAAGGATTATGCTCCCTTGAAGGAAACCAGTCCCATGCTGCCCC
TGCGACCAGAAGCCGGAGCAAGTGGAGGCGCAGGAGGATCCGCTCAGTCG
GTGGCCAAGGCAATCGACAAAACAGTGCAGGACTTCGATGCCAAGTTCAC
CTCCTCCTTGGTGGCAAAGGCCTCTAGCACACTGGCCCATTCGGAGCCCC
ATATGGAGACGCTGAAGAAGAGCGATTCTGCCCAGGAGGAGCAGGAACAC
GATACTTGCGATCAGCGGCTGGCGGGCAGTGGAGACCTGGACCTGCCATC
CTTGGCGCCCTTGGAGTTGCCCTCCTTCGATTACAGCCTGTTCACCAGCT
CCTCGGCTCCTTCGTTGGCCAGCTATGCCGGCATGGCTGAGAGCTTCCAG
AAATAGGCCTGGTTAAGATCCATTTGTAAAACTTCAACTAATTTGAAAGA
TCTCGTGGTAATGCAGTGCCCGCTGAGTGGTGATTAGGATTTAATTTTAG
GCACGTTCTTCATTTCAACGTTTTGTGCAGTTCCCTTTGTGAAGTGTATT
TGGGAATTCTCTAAATAAATTAAATTAGGTTAATTCACAATAATAATAAT
AATAATAATACTTTGTGTATTACAAAAAAAAAAAAAAAAAAAAAAA

MIP29328.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 835716..836551 188..1023 4030 98.8 Plus
chr3L 24539361 chr3L 835467..835652 1..189 790 95.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-RA 642 CG42554-PA 1..642 165..806 3210 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-RA 1023 CG42554-RA 1..1023 1..1023 5115 100 Plus
CG13901-RB 919 CG13901-RB 816..919 1023..920 520 100 Minus
CG13901-RA 911 CG13901-RA 808..911 1023..920 520 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-PA 213 CG42554-PA 1..213 165..803 991 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 835935..836772 188..1025 4190 100 Plus
3L 28110227 3L 835683..835871 1..189 945 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 835935..836772 188..1025 4190 100 Plus
3L 28103327 3L 835683..835871 1..189 945 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:52:37 has no hits.

MIP29328.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:25:21 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 835717..836515 189..987 98 <- Plus
chr3L 835467..835651 1..188 95 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 13:26:20 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 1..642 165..806 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:49 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 1..642 165..806 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:21 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 1..642 165..806 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 13:26:19 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 1..682 125..806 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:49 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 1..1023 1..1023 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:21 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
CG42554-RA 1..1023 1..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:25:21 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
3L 835936..836770 189..1023 100   Plus
3L 835683..835870 1..188 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:49 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 835936..836770 189..1023 100   Plus
arm_3L 835683..835870 1..188 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:17 Download gff for MIP29328.complete
Subject Subject Range Query Range Percent Splice Strand
3L 835936..836770 189..1023 100   Plus
3L 835683..835870 1..188 100 -> Plus

MIP29328.pep Sequence

Translation from 164 to 805

> MIP29328.pep
MDCAPLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPK
SKEVLDTLTLDFQRKLRQIEMRKTQHGLNKLKDYAPLKETSPMLPLRPEA
GASGGAGGSAQSVAKAIDKTVQDFDAKFTSSLVAKASSTLAHSEPHMETL
KKSDSAQEEQEHDTCDQRLAGSGDLDLPSLAPLELPSFDYSLFTSSSAPS
LASYAGMAESFQK*

MIP29328.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24778-PA 208 GF24778-PA 1..208 1..213 830 79.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14737-PA 212 GG14737-PA 1..212 1..213 976 93 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15421-PA 207 GH15421-PA 1..207 1..213 760 71.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-PA 213 CG42554-PA 1..213 1..213 1077 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16951-PA 213 GI16951-PA 17..213 9..213 703 69.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13574-PA 213 GD13574-PA 1..213 1..213 1089 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12119-PA 187 GJ12119-PA 1..187 20..213 658 72.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10880-PA 210 GK10880-PA 1..210 1..213 785 74.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21101-PA 212 GE21101-PA 1..212 1..213 984 93.4 Plus

MIP29328.hyp Sequence

Translation from 164 to 805

> MIP29328.hyp
MDCAPLNLAHFHERRSERFIRNHRYEEAIKALETSLIYMQDAQKRVALPK
SKEVLDTLTLDFQRKLRQIEMRKTQHGLNKLKDYAPLKETSPMLPLRPEA
GASGGAGGSAQSVAKAIDKTVQDFDAKFTSSLVAKASSTLAHSEPHMETL
KKSDSAQEEQEHDTCDQRLAGSGDLDLPSLAPLELPSFDYSLFTSSSAPS
LASYAGMAESFQK*

MIP29328.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42554-PA 213 CG42554-PA 1..213 1..213 1077 100 Plus