Clone MIP29336 Report

Search the DGRC for MIP29336

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:293
Well:36
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43089-RB
Protein status:MIP29336.pep: gold
Sequenced Size:532

Clone Sequence Records

MIP29336.complete Sequence

532 bp assembled on 2011-03-01

GenBank Submission: BT126309.1

> MIP29336.complete
GAAAAAAACTAAGTTGGCATTTGCTACAAGTCAAAGGCATTTTTTAGCAC
TTATCAAAATGTCGTCCTCTTCTTCAGAAGCAATTCAACTTCAGACCAAC
GATGGTGTCATTCATACAGTGGACATGCGCTTTGCTCTACAGATATGCCC
CGTGCGCAATATGATAATGCAGGAGAGACAGAAAAATTTGCACACCGATG
ATGTTATCCCTCTACCGAGAGTCGATGCCAAAAACCTTCGATTTATAATC
AAGTGGTGGACATCTGTGCAGAATCTAGATGAAAATCTTCTCACTATGGG
CAAAAGAAAACTTAAGCAGTTGCTAACGGCGGAACATGCCAACCATCAGT
TTCTGCTGCAAATCATCCTTGCCGCCGACTATCTGCAAATGGAGAAATTT
TTGCTGATCAGCACACATCTCATGGCGGATGCTTTAAATGAATGTGAAAG
TGTCGAAGAGATACGTAGAAAGTTTTTTTGGAATAAAGTGTAAAATCATC
GATGGAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP29336.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 17:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3713468..3713941 31..504 2310 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-RB 435 CG43089-PB 1..435 59..493 2175 100 Plus
CG43089-RC 435 CG43089-PC 1..435 59..493 2175 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-RB 499 CG43089-RB 1..499 6..504 2495 100 Plus
CG43089-RC 638 CG43089-RC 1..499 6..504 2495 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-PB 144 CG43089-PB 1..144 59..490 739 100 Plus
CG43089-PC 144 CG43089-PC 1..144 59..490 739 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3714105..3714578 31..504 2370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3714105..3714578 31..504 2370 100 Plus
3L 28103327 3L 3714027..3714058 6..37 160 100 Plus
Blast to na_te.dros performed on 2014-11-27 17:22:45 has no hits.

MIP29336.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:10:22 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3713474..3713941 37..505 98   Plus
chr3L 3713390..3713420 6..36 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:32 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RA 1..435 59..493 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:04 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RC 1..435 59..493 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:22 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RC 1..435 59..493 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:32 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RA 46..525 25..505 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:04 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RC 1..499 6..505 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:22 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RC 1..499 6..505 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:10:22 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3714111..3714578 37..505 99   Plus
3L 3714027..3714057 6..36 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:04 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3714111..3714578 37..505 99   Plus
arm_3L 3714027..3714057 6..36 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:12 Download gff for MIP29336.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3714111..3714578 37..505 99   Plus
3L 3714027..3714057 6..36 100 -> Plus

MIP29336.pep Sequence

Translation from 1 to 492

> MIP29336.pep
KKTKLAFATSQRHFLALIKMSSSSSEAIQLQTNDGVIHTVDMRFALQICP
VRNMIMQERQKNLHTDDVIPLPRVDAKNLRFIIKWWTSVQNLDENLLTMG
KRKLKQLLTAEHANHQFLLQIILAADYLQMEKFLLISTHLMADALNECES
VEEIRRKFFWNKV*

MIP29336.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24221-PA 155 GF24221-PA 14..142 28..158 171 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16422-PA 160 GH16422-PA 4..147 24..158 165 27.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-PB 144 CG43089-PB 1..144 20..163 739 100 Plus
CG43089-PC 144 CG43089-PC 1..144 20..163 739 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12503-PA 151 GI12503-PA 2..141 28..158 171 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12411-PA 159 GJ12411-PA 2..149 22..158 185 29.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22408-PA 144 GK22408-PA 15..141 28..158 136 25 Plus

MIP29336.hyp Sequence

Translation from 7 to 492

> MIP29336.hyp
TKLAFATSQRHFLALIKMSSSSSEAIQLQTNDGVIHTVDMRFALQICPVR
NMIMQERQKNLHTDDVIPLPRVDAKNLRFIIKWWTSVQNLDENLLTMGKR
KLKQLLTAEHANHQFLLQIILAADYLQMEKFLLISTHLMADALNECESVE
EIRRKFFWNKV*

MIP29336.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-PB 144 CG43089-PB 1..144 18..161 739 100 Plus
CG43089-PC 144 CG43089-PC 1..144 18..161 739 100 Plus