Clone MIP29367 Report

Search the DGRC for MIP29367

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:293
Well:67
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42737-RA
Protein status:MIP29367.pep: wuzgold
Sequenced Size:487

Clone Sequence Records

MIP29367.complete Sequence

487 bp assembled on 2011-03-01

GenBank Submission: BT126111.1

> MIP29367.complete
AGCGATGGGGCTTTTGGAAAACCCAAAGATCTATAAAATATTCTAGGGTA
TTTTCTGTTACTCCCGTGTTATTCACCGTCGAGATGAAAAGATGCAGCCG
TATAAATCGCACTGGAATTGAGCGATCGCAGTTATTGACTCGTCTCAATT
GTCGCAGCGATGAAGTGGTTTTCGATTTTGTTTGCGCTACTGGCGCTCAT
TTTCTTCGTCGAATTTGGATATGCTCGAACAATTCCCAGGATTACCATTC
GCAATGGCGACATTATAGTTCATGGCAATTGCAATGACTGCACGGCACGC
GCCACCAAAAACTCGGCTCACTTATCAATCAAATTTACTCGAAGATGGTA
AATGTATTTATAAATAAATTACCTCAAACTTGCCATATTAAAACAAAAAA
CAAAAACTAATTTAAACTACTAAGTATTAGCTTGTGTGCATAAAATAAAA
AGAAGTAACTATTATGCTAAAAAAAAAAAAAAAAAAA

MIP29367.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 17:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14268430..14268671 468..227 1180 99.2 Minus
chr2R 21145070 chr2R 14268733..14268959 227..1 1090 98.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43202-RA 192 CG43202-PA 1..192 160..351 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG43202-RA 390 CG43202-RA 1..390 79..468 1950 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43202-PA 63 CG43202-PA 1..63 160..348 263 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18381390..18381634 471..227 1225 100 Minus
2R 25286936 2R 18381696..18381922 227..1 1135 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18382589..18382833 471..227 1225 100 Minus
2R 25260384 2R 18382895..18383121 227..1 1135 100 Minus
Blast to na_te.dros performed on 2014-11-27 17:23:54 has no hits.

MIP29367.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:11:00 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14268734..14268959 1..226 98   Minus
chr2R 14268430..14268671 227..468 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 11:23:06 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
CG42737-RA 1..204 84..287 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:32 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
CG43202-RA 1..192 160..351 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:11:00 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
CG43202-RA 1..192 160..351 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 11:23:05 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
CG42737-RA 1..209 79..287 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:32 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
CG43202-RA 1..390 79..468 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:11:00 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
CG43202-RA 1..390 79..468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:11:00 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18381697..18381922 1..226 100   Minus
2R 18381393..18381634 227..468 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:32 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14269202..14269427 1..226 100   Minus
arm_2R 14268898..14269139 227..468 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:09 Download gff for MIP29367.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18382896..18383121 1..226 100   Minus
2R 18382592..18382833 227..468 100 <- Minus

MIP29367.pep Sequence

Translation from 2 to 286

> MIP29367.pep
RWGFWKTQRSIKYSRVFSVTPVLFTVEMKRCSRINRTGIERSQLLTRLNC
RSDEVVFDFVCATGAHFLRRIWICSNNSQDYHSQWRHYSSWQLQ*
Sequence MIP29367.pep has no blast hits.

MIP29367.hyp Sequence

Translation from 2 to 286

> MIP29367.hyp
RWGFWKTQRSIKYSRVFSVTPVLFTVEMKRCSRINRTGIERSQLLTRLNC
RSDEVVFDFVCATGAHFLRRIWICSNNSQDYHSQWRHYSSWQLQ*
Sequence MIP29367.hyp has no blast hits.