Clone MIP29442 Report

Search the DGRC for MIP29442

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:294
Well:42
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42870-RA
Protein status:MIP29442.pep: wuzgold
Sequenced Size:371

Clone Sequence Records

MIP29442.complete Sequence

371 bp assembled on 2011-03-01

GenBank Submission: BT126109.1

> MIP29442.complete
CTTAGTATTGCATTTAATATTGTGATTCGGATGCTTTTGGGCATGGCCAT
CGCTTTTCCCACTCATCAGTTCGTGCCACACATACCTTATGGCATGGATG
ACTTTTACCCGTTTCTTGCCAGAAATTCCACCGATGTGCTGCCGTTGTCT
ACAAATCTAACTCAAATTGAACGACTAGGATGGGCCGATAAATGTGTGCA
GTTTAGAAATAAGTGCACATTAGCAGAGCATTGTTGCAGTCTTAGATGCC
TGAAACGTATTTATCGATGCATTACCTAAGCTGTATATCGAAGATTGTCT
CCTAAAAGTATTTTATAATAAAAATATGTTATTTAAATAAAAATCTTTTA
CTTGAAAAAAAAAAAAAAAAA

MIP29442.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 17:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17560695..17560883 354..166 930 99.5 Minus
chr3R 27901430 chr3R 17560948..17561112 165..1 810 99.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-RB 285 CG42870-PB 7..285 1..279 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-RB 368 CG42870-RB 15..368 1..354 1770 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-PB 94 CG42870-PB 3..94 1..276 499 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21736932..21737121 355..166 950 100 Minus
3R 32079331 3R 21737186..21737350 165..1 825 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21477763..21477952 355..166 950 100 Minus
3R 31820162 3R 21478017..21478181 165..1 825 100 Minus
Blast to na_te.dros performed on 2014-11-27 17:23:30 has no hits.

MIP29442.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:10:46 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17560948..17561112 1..165 99   Minus
chr3R 17560742..17560883 166..307 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 11:05:54 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RA 1..186 94..279 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:19 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 7..285 1..279 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:46 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 7..285 1..279 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 11:05:53 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RA 1..282 21..302 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:19 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 15..368 1..354 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:46 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
CG42870-RB 15..368 1..354 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:10:46 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21737186..21737350 1..165 100   Minus
3R 21736933..21737121 166..354 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:19 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17562908..17563072 1..165 100   Minus
arm_3R 17562655..17562843 166..354 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:24 Download gff for MIP29442.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21478017..21478181 1..165 100   Minus
3R 21477764..21477952 166..354 100 <- Minus

MIP29442.pep Sequence

Translation from 0 to 278

> MIP29442.pep
LSIAFNIVIRMLLGMAIAFPTHQFVPHIPYGMDDFYPFLARNSTDVLPLS
TNLTQIERLGWADKCVQFRNKCTLAEHCCSLRCLKRIYRCIT*

MIP29442.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-PB 94 CG42870-PB 3..94 1..92 499 100 Plus

MIP29442.hyp Sequence

Translation from 0 to 278

> MIP29442.hyp
LSIAFNIVIRMLLGMAIAFPTHQFVPHIPYGMDDFYPFLARNSTDVLPLS
TNLTQIERLGWADKCVQFRNKCTLAEHCCSLRCLKRIYRCIT*

MIP29442.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42870-PB 94 CG42870-PB 3..94 1..92 499 100 Plus