Clone RE01075 Report

Search the DGRC for RE01075

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:10
Well:75
Vector:pFlc-1
Associated Gene/Transcriptect-RD
Protein status:RE01075.pep: gold
Sequenced Size:2438

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6611 2003-02-13 Blastp of sequenced clone
ect 2008-04-29 Release 5.5 accounting
ect 2008-08-15 Release 5.9 accounting
ect 2008-12-18 5.12 accounting

Clone Sequence Records

RE01075.complete Sequence

2438 bp (2438 high quality bases) assembled on 2003-02-13

GenBank Submission: BT003781

> RE01075.complete
AGTTGCAGACGGTCAGTCGAGCGAGACAGTTGTGTGCGCGCCGGTGTTGG
AAACCCGAACTCGAATTCGAACCACTGAAGAGCCAGCCAAGCTCAGGCCA
GAATCCACCATCGACTCGAATCGAATCGAAACGAATCGAATCGCCACAAA
AATAAAAAAGAAACCAACACAAACAGATCTGACAACATGAAGTTCGTGAT
TTTGCTGTGCGTGCTGAGCGCGTTGCTGCTGCAAATTGAAGCGTCGCCCC
TCCAGCGGCTTTCGAGAAGCGAGCGGGCTGTTTCCCGCCAACAGACGGTC
AACAATGAGGTGGCTCCGGCGGTAGCTCCTGCCAGCGATGATGACGATGA
TGACGACGATGAGGACGACGATGATGAGCCTGATCTAGGAGATCTGATCG
ATGACGATGATGATGATGATGAGGAGGAGGACGATGACGAGGACGAGGAG
GATGATACGCCCCAGGGTCAGGCTGCTCCAGCGGCCACTGCCAGCGATGA
TGACGAAGAGGAAGACGATGATGATGACGATTATCTGGACAGGCTGTTCG
ATGATATCCTGGGCGATGATGAAGATGAGGATGATGATGACGAGACACCC
GCTGCCACCGCCCAGCAGAGCGCTGTGGCCGCCGCTCCCGCCCAAACTCT
GGATGAGGTCGCCCCCGCTGCCGCCTCCTCCGTGAGCGCCGGTATCTCCG
ATGGTGTTGATCTGCCCGCCGAGTCCGGAAATGCCGCTGAGGTCCTGGCC
GCTGGAAATGCTGCCGATGAGTCCGTTTCCGCTGCCGTTGCTCCGGCGCA
AAACGCTGCCGCCAGCAGCAGCAACAACGAAGGTATCGCCGGTGACGACG
ACGAGGAGGCCGACGATGATGATGACGATGACGACGATGACATTATCGGC
GATGACATCATCGAGGCCCGCCGTGAAGCACGTGAGTCCAAATCGAAGTC
GGAAACGGCGACGAAAGAAACCAAGGCCAAGAAATCAACAAGTCCCTCAA
AGAAGGCCAAGAAAGAGCTGAAGCATTAACCAAACAAACTGCTAAATGAA
CAACAACAACCGCAACAACCACTAAAGACAGGGACCCACAACAACAACAA
AATAACAGAGAACGACATGCCCCAAAAGCAAAAAAAAGACGAAAAAGGAA
AGCGAATTTTCTGAACATTTTCCCATGGGGCAGGACGCGATCCGGACTTT
TGCAATTGCATCTTTGCCTGCACTGACTATCCTCCCACATCCCTCGCTAT
CCTTTAATTTATGAAACAAAATCTGAGTTAAGTACATATGTTTATGCATC
CCCGAAAAGGGGATGGAATTATCGAGAGTTTGGTGCTAGTCAAACTATCT
GCAAAACAACAAAAGCAGCACAATTATTCCCAATTCTTTCCACTGTATCC
CTCCAACGCACAATTGTTGAGTTATTTACGCACGGACTGTTTCACCTGAC
TAAAGAAATGCAACACCAACTGTACGCACAACTGCAACGCTAGTTGCAGC
TGCAACCGCAACAGCAACATGTTTAATGCCCAAGCACAAAAATGGTTGAA
TTCAAAGAGATCACAAAGCAAAAGAAGATGATGATGATGATGAAGAAGAT
GAAGAAGGCGCAGAAGAATCGAAAGGCGGAAGAGCGGCAAGAGGCAGAGC
AAGAGAAGAATTGATAGAAAGAGATATCGCTGAAAGAAAGGCTTCCCTTG
CTCTCTCTTTCCCATTCCATCACATTCACATATCTCCCTCTCTCTCTCTG
CCTATCTTTCTCACACACACACACACGCCCCGCACGTATAGCTAAATTGA
TGTAACACCAACAAACACAACAGCAATAAGAATTGTTCACTTTGTGTAAT
TTATTTATTTCTAGTTGTAATATCTTTTTCGTATTTATTTGTGTAATTAA
ACAAAGCAATCGATCAGATTCGGAATTAGATATCATTATGTAAACAACTG
CCTATCTCACTCGCTCTCTCTCTTACTATGTCTATGTCTGTCTCTCTTAT
GCACACACACACACGCATTTAAGCACTATCGCTATCTCTTGCTTTCACAC
ATTTGGCTTACAATTGAACATTTTAGATGAAACAAAAGATGTATATCTTT
TTGTACCTTTGGCTTTTTCTCTAACTTTTTTCGGCTCGCATAATTTTCCG
AACGTAAATAACGCAAATTTTGTAAAAAATATGGAAAAAACTCAATCAAA
CTTAAAAATCAGCAATAAATTGTAGCTAAAAGTTGGACGCTTGAAAGGCA
GCGCAAAATTTCACAAGAAGAAATAGAGAATTGTTAAACTTTGCGTTTTA
GGTCATCTAATTTATAATTTATTATTTATTTATTTATTTATTTATTTATT
ATAAAAACAAAAGCAAGAAGATGAAGAACAAAACCACAAAACAATAAATT
TGCTTAAATAAATTTGCGAAATAAAAAAAAAAAAAAAA

RE01075.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
ect-RD 2463 ect-RD 11..2436 1..2426 12100 99.9 Plus
ect.a 2710 ect.a 258..2683 1..2426 12100 99.9 Plus
ect.b 2372 ect.b 255..1189 1..935 4675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10185167..10186764 2422..831 7530 98.4 Minus
chr3L 24539361 chr3L 10187208..10187477 834..565 1305 98.9 Minus
chr3L 24539361 chr3L 10187975..10188213 412..174 1180 99.6 Minus
chr3L 24539361 chr3L 10187586..10187739 565..412 770 100 Minus
chr3L 24539361 chr3L 10193435..10193600 176..1 695 94.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
ect-RD 843 CG6611-PD 1..843 187..1029 4215 100 Plus
ect-RB 1746 CG6611-PB 1..749 187..935 3745 100 Plus
ect-RA 1746 CG6611-PA 1..749 187..935 3745 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:24:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
ect-RD 2426 CG6611-RD 5..2426 1..2422 12095 100 Plus
ect-RA 2103 CG6611-RA 5..939 1..935 4675 100 Plus
ect-RB 2046 CG6611-RB 122..882 175..935 3805 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-26 20:25:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10193402..10194997 2426..831 7950 99.9 Minus
3L 28110227 3L 10195441..10195710 834..565 1350 100 Minus
3L 28110227 3L 10196208..10196446 412..174 1195 100 Minus
3L 28110227 3L 10201658..10201833 176..1 880 100 Minus
3L 28110227 3L 10195819..10195972 565..412 770 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10186502..10188097 2426..831 7950 99.8 Minus
3L 28103327 3L 10188541..10188810 834..565 1350 100 Minus
3L 28103327 3L 10189308..10189546 412..174 1195 100 Minus
3L 28103327 3L 10194758..10194933 176..1 880 100 Minus
3L 28103327 3L 10188919..10189072 565..412 770 100 Minus
3L 28103327 3L 10189348..10189391 531..488 145 88.6 Minus
Blast to na_te.dros performed 2014-11-26 20:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1503..1606 1443..1543 144 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2332..2395 1456..1519 140 68.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6765..6830 1456..1521 132 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6729..6795 1453..1519 128 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2330..2389 1460..1519 120 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6828..6894 1453..1519 119 64.2 Plus
gypsy4 6852 gypsy4 GYPSY4 6852bp 1837..1885 1104..1152 119 71.4 Plus

RE01075.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:14:51 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10187208..10187476 566..834 98 <- Minus
chr3L 10186547..10186703 892..1048 100 == Minus
chr3L 10186031..10186477 1118..1565 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:23 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RB 1..751 187..939 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:51:38 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 1..843 187..1029 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:06:10 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 1..843 187..1029 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:42:46 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RB 1..751 187..939 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:51 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 1..843 187..1029 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed on 2008-11-10 20:05:18 has no hits.
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:51:38 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 1..2422 1..2422 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:10 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 5..2426 1..2422 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:33:15 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RA 2..936 1..935 100 == Plus
ect-RA 2024..2049 2324..2353 83   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:51 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
ect-RD 5..2426 1..2422 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:14:51 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10201658..10201833 1..176 100   Minus
3L 10196208..10196443 177..412 100 <- Minus
3L 10195819..10195971 413..565 100 <- Minus
3L 10195443..10195709 566..832 100 <- Minus
3L 10193406..10194995 833..2422 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:10 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10194758..10194933 1..176 100   Minus
arm_3L 10189308..10189543 177..412 100 <- Minus
arm_3L 10188919..10189071 413..565 100 <- Minus
arm_3L 10188543..10188809 566..832 100 <- Minus
arm_3L 10186506..10188095 833..2422 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:13:32 Download gff for RE01075.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10194758..10194933 1..176 100   Minus
3L 10189308..10189543 177..412 100 <- Minus
3L 10188919..10189071 413..565 100 <- Minus
3L 10188543..10188809 566..832 100 <- Minus
3L 10186506..10188095 833..2422 99 <- Minus

RE01075.pep Sequence

Translation from 186 to 1028

> RE01075.pep
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS
DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDETPAATAQQSAVAAA
PAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAEVLAAGNAADESVSAA
VAPAQNAAASSSNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARE
SKSKSETATKETKAKKSTSPSKKAKKELKH*

RE01075.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23838-PA 602 GF23838-PA 1..254 1..252 439 84.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13981-PA 586 GG13981-PA 1..252 1..252 406 97.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
ect-PD 280 CG6611-PD 1..280 1..280 1407 100 Plus
ect-PB 581 CG6611-PB 1..253 1..253 1263 98.8 Plus
ect-PA 581 CG6611-PA 1..253 1..253 1263 98.8 Plus
ect-PF 589 CG6611-PF 1..261 1..253 1244 95.8 Plus
ect-PE 548 CG6611-PE 1..216 1..216 1084 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13848-PA 589 GI13848-PA 1..254 1..252 307 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11751-PA 567 GL11751-PA 1..191 1..191 348 78.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19722-PA 609 GA19722-PA 1..191 1..191 349 78.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24817-PA 467 GM24817-PA 1..125 1..126 265 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12869-PA 581 GD12869-PA 1..253 1..253 1193 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11712-PA 589 GJ11712-PA 1..252 1..252 298 79.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24084-PA 675 GK24084-PA 1..263 1..252 239 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20279-PA 588 GE20279-PA 1..205 1..205 516 97.6 Plus

RE01075.hyp Sequence

Translation from 186 to 1028

> RE01075.hyp
MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS
DDDDDDDDEDDDDEPDLGDLIDDDDDDDEEEDDDEDEEDDTPQGQAAPAA
TASDDDEEEDDDDDDYLDRLFDDILGDDEDEDDDDETPAATAQQSAVAAA
PAQTLDEVAPAAASSVSAGISDGVDLPAESGNAAEVLAAGNAADESVSAA
VAPAQNAAASSSNNEGIAGDDDEEADDDDDDDDDDIIGDDIIEARREARE
SKSKSETATKETKAKKSTSPSKKAKKELKH*

RE01075.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:00:46
Subject Length Description Subject Range Query Range Score Percent Strand
ect-PD 280 CG6611-PD 1..280 1..280 1407 100 Plus
ect-PB 581 CG6611-PB 1..253 1..253 1263 98.8 Plus
ect-PA 581 CG6611-PA 1..253 1..253 1263 98.8 Plus
ect-PF 589 CG6611-PF 1..261 1..253 1244 95.8 Plus
ect-PE 548 CG6611-PE 1..216 1..216 1084 100 Plus