Clone RE02778 Report

Search the DGRC for RE02778

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:27
Well:78
Vector:pFlc-1
Associated Gene/TranscriptCG3209-RC
Protein status:RE02778.pep: gold
Sequenced Size:1695

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3209-RA 2009-01-26 Manual selection by Sue Celniker

Clone Sequence Records

RE02778.complete Sequence

1695 bp assembled on 2009-03-10

GenBank Submission: BT072873.1

> RE02778.complete
ATTGCATATATTGGCACGACACAATTCGGAGGCATTTTTCGCTTAACAAT
AACTAATGTCGCATGACACAAATGTAAAATGATCGCCGTGCTGTTGGACA
TATTCTGGATCCCCATCGGGGGCTTCCTCTCATTTCTCATATTTATTTCC
GCCATAAACAAATCAATCGGCGTCCGAAAAGCGTACGTGAACCTCCTCCT
AAGGATATTCGAGTATGGTCGAGTTAGTATAGAGACAGCATCCAAAGAAA
ACCAACACATTCAAAATCCCAAGACTGACGACAAACAGGGAGTGCAACTA
GTGGACGACGCCGATTCCAAAGAAGGCACCAATGGAGCCACATTGATTAC
CAGGGACGCGGTACTCCTGCCCCAGCCACAGGAGCCCGCTCCAGAGAAGC
CAGTTTCCTCCACAAAGGATGAAATCAATTTCGATTTTGAGAAATGCCTG
GACTACGTAAAGTCTGGCGTGGAGGCCATCATCGAGGACGATGTTACGTC
GCGCTTCGAGGCGGAGGAGCTCAAGAGCTGGAACATGCTGACACGCACCA
ATAGGCACTACGAGTTCATTTCCTGGAAAATCACCTCCATCTGGGTGTTC
GGCTTCTTCATCCGCTACGTCATCCTGATGCCCCTCCGGGTATTGGTATG
CTTCGTTGGTGTTTTATTTGCAGTTTTATCAAGCTCCATTGTGGCTTGTT
TACCTTTTCGATTTGTACGGCTTTCTCTAGCGAGCTTGTCATTCAAAATT
ACGTTCCGCCTTATTTCAAGTTCTATGTCCTCCTTTATCAAGTTCCACAA
TAAGCAATATAAGCCCACAGTCTCTGGGTTCTGTGTAGCCAACCACACCT
CTCCCTTGGATGTGGCTATATTATCGACCGATTGTACCTACTCTTTGATT
GGCCAACGCCATGGCGGCTTTTTGGGGGTGCTGCAACGAGCTCTGGCCCG
CGCATCTCCCCACATTTGGTTTGAGCGCGGCGAGGCCAAGGATCGTCATT
TGGTGGCCGAGCGACTGAAGCAGCACGTGTCTGATCCGAACAACCCACCG
ATCCTTATCTTCCCGGAGGGAACTTGCATCAACAACACGTCGGTCATGCA
GTTCAAGAAGGGCAGCTTCGAAGTTGGCGGCGTCATCTACCCGGTGGCCA
TTAAGTACGATCCGAGGTTCGGCGACGCCTTCTGGAACAGCGCGAAGTAC
TCGATGATGCAGTATCTGTACATGATGATGACCTCGTGGGCCATCGTGTG
CGATGTGTGGTACCTGCCGCCGATGTACAGGCAGGAGGGAGAGTCGGCGA
TCGACTTCGCGAACCGCGTGAAGAGTGTCATCGCGAAGCAGGGAGGTTTG
ATTGATCTGGTCTGGGACGGGCAGCTGAAGCGCATGAAGCCAAAGAAGGA
GTGGAGGGAGATCCAGCAAGTCGAGTTTGCCAATCGGCTGAAGTCGGACT
CCACCTAAATTACCATATTACCATACAGTGACTGTAAATGATATACATAC
ATGATTTTGCATAATTTGTATTGCAGCGACTGTAATTTGTATAAATTACG
ATTAACAATTGGATGGTTAAATAAAAGATGAAGTCAAATGTACAATTATA
ATAATTATTTGTATATTAATTAATTTATCTACTTTGTAAAATAAACGATA
TCTGATAAGCTGATTATCATAACATCTAGAAAAAAAAAAAAAAAA

RE02778.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-RC 2089 CG3209-RC 366..2042 1..1677 8370 99.9 Plus
CG3209.g 2848 CG3209.g 366..2042 1..1677 8370 99.9 Plus
CG3209.a 2125 CG3209.a 213..1109 1..897 4470 99.8 Plus
CG3209.a 2125 CG3209.a 1332..2123 886..1677 3930 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19959033..19959555 1155..1677 2615 100 Plus
chr2R 21145070 chr2R 19958709..19958968 897..1156 1240 98.5 Plus
chr2R 21145070 chr2R 19956014..19956260 416..662 1235 100 Plus
chr2R 21145070 chr2R 19956773..19957009 661..897 1185 100 Plus
chr2R 21145070 chr2R 19955138..19955350 1..213 1035 99.1 Plus
chr2R 21145070 chr2R 19955753..19955959 212..418 1020 99.5 Plus
chrX 22417052 chrX 20690472..20690615 1048..1191 240 77.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-RC 1380 CG3209-PC 1..1380 79..1458 6900 100 Plus
CG3209-RD 1614 CG3209-PD 1..819 79..897 4095 100 Plus
CG3209-RB 1377 CG3209-PB 1..584 79..662 2920 100 Plus
CG3209-RD 1614 CG3209-PD 1042..1614 886..1458 2835 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:26:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-RC 1751 CG3209-RC 73..1749 1..1677 8370 99.9 Plus
CG3209-RD 1985 CG3209-RD 73..969 1..897 4470 99.9 Plus
CG3209-RD 1985 CG3209-RD 1192..1983 886..1677 3930 99.7 Plus
CG3209-RE 1807 CG3209-RE 1026..1805 898..1677 3900 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-PC 459 CG3209-PC 1..459 79..1455 2393 100 Plus
CG3209-PB 458 CG3209-PB 1..458 79..1455 2133 89.3 Plus
CG3209-PD 537 CG3209-PD 1..274 79..900 1398 99.6 Plus
CG3209-PD 537 CG3209-PD 305..537 754..1455 1134 90.6 Plus
CG3209-PE 380 CG3209-PE 1..195 79..663 1004 99.5 Plus
CG3209-PE 380 CG3209-PE 195..380 898..1455 998 100 Plus
CG15450-PA 407 CG15450-PA 75..407 415..1407 848 45.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24073028..24073550 1155..1677 2615 100 Plus
2R 25286936 2R 24072704..24072963 897..1156 1300 100 Plus
2R 25286936 2R 24069998..24070244 416..662 1235 100 Plus
2R 25286936 2R 24070768..24071004 661..897 1185 100 Plus
2R 25286936 2R 24069122..24069334 1..213 1050 99.5 Plus
2R 25286936 2R 24069737..24069943 212..418 1035 100 Plus
X 23542271 X 20825153..20825296 1048..1191 240 77.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24074227..24074749 1155..1677 2615 100 Plus
2R 25260384 2R 24073903..24074162 897..1156 1300 100 Plus
2R 25260384 2R 24071197..24071443 416..662 1235 100 Plus
2R 25260384 2R 24071967..24072203 661..897 1185 100 Plus
2R 25260384 2R 24070321..24070533 1..213 1050 99.5 Plus
2R 25260384 2R 24070936..24071142 212..418 1035 100 Plus
X 23527363 X 20810245..20810388 1048..1191 240 77.7 Plus
Blast to na_te.dros performed on 2014-11-26 21:18:04 has no hits.

RE02778.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:32:40 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19959033..19959556 1155..1679 93   Plus
chr2R 19958710..19958966 898..1154 98 -> Plus
chr2R 19956773..19957009 661..897 100 -> Plus
chr2R 19956016..19956258 418..660 100 -> Plus
chr2R 19955755..19955958 214..417 99 -> Plus
chr2R 19955138..19955350 1..213 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:11 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RA 1..814 79..892 100 <- Plus
CG3209-RA 1048..1614 893..1458 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:29 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 1..1380 79..1458 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:25:42 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 1..1380 79..1458 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:40 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 1..1380 79..1458 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 12:50:24 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RA 213..1104 1..892 99 <- Plus
CG3209-RA 1338..2047 893..1601 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:29 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 213..1890 1..1679 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:25:42 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 73..1750 1..1679 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:40 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
CG3209-RC 73..1750 1..1679 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:32:40 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24073028..24073551 1155..1679 99   Plus
2R 24072705..24072961 898..1154 100 -> Plus
2R 24070768..24071004 661..897 100 -> Plus
2R 24070000..24070242 418..660 100 -> Plus
2R 24069739..24069942 214..417 100 -> Plus
2R 24069122..24069334 1..213 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:25:42 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19960551..19961074 1155..1679 99   Plus
arm_2R 19960228..19960484 898..1154 100 -> Plus
arm_2R 19958291..19958527 661..897 100 -> Plus
arm_2R 19957523..19957765 418..660 100 -> Plus
arm_2R 19957262..19957465 214..417 100 -> Plus
arm_2R 19956645..19956857 1..213 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:32 Download gff for RE02778.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24074245..24074768 1155..1679 99   Plus
2R 24073922..24074178 898..1154 100 -> Plus
2R 24071985..24072221 661..897 100 -> Plus
2R 24071217..24071459 418..660 100 -> Plus
2R 24070956..24071159 214..417 100 -> Plus
2R 24070339..24070551 1..213 99 -> Plus

RE02778.pep Sequence

Translation from 78 to 1457

> RE02778.pep
MIAVLLDIFWIPIGGFLSFLIFISAINKSIGVRKAYVNLLLRIFEYGRVS
IETASKENQHIQNPKTDDKQGVQLVDDADSKEGTNGATLITRDAVLLPQP
QEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKS
WNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVLFAVL
SSSIVACLPFRFVRLSLASLSFKITFRLISSSMSSFIKFHNKQYKPTVSG
FCVANHTSPLDVAILSTDCTYSLIGQRHGGFLGVLQRALARASPHIWFER
GEAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVG
GVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMY
RQEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEF
ANRLKSDST*

RE02778.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 00:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11367-PA 539 GF11367-PA 1..276 1..274 1265 88 Plus
Dana\GF11367-PA 539 GF11367-PA 303..539 222..459 1175 88.7 Plus
Dana\GF21703-PA 440 GF21703-PA 108..440 113..443 889 46.7 Plus
Dana\GF22630-PA 558 GF22630-PA 178..351 253..424 196 29 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 00:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22933-PA 537 GG22933-PA 1..274 1..274 1406 97.4 Plus
Dere\GG22933-PA 537 GG22933-PA 303..537 224..459 1173 89.8 Plus
Dere\GG19698-PA 439 GG19698-PA 107..439 113..443 869 45.8 Plus
Dere\GG18969-PA 474 GG18969-PA 64..331 169..424 206 25.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 00:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21717-PA 537 GH21717-PA 1..537 1..457 1777 65.3 Plus
Dgri\GH17744-PA 405 GH17744-PA 59..405 99..443 870 45.4 Plus
Dgri\GH12406-PA 556 GH12406-PA 84..345 171..420 220 25.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-PC 459 CG3209-PC 1..459 1..459 2393 100 Plus
CG3209-PB 458 CG3209-PB 1..458 1..459 2133 89.3 Plus
CG3209-PD 537 CG3209-PD 1..274 1..274 1398 99.6 Plus
CG3209-PD 537 CG3209-PD 305..537 226..459 1134 90.6 Plus
CG3209-PE 380 CG3209-PE 1..195 1..195 1004 99.5 Plus
CG3209-PE 380 CG3209-PE 195..380 274..459 998 100 Plus
CG15450-PA 407 CG15450-PA 75..407 113..443 848 45.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 00:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18864-PA 538 GI18864-PA 1..538 1..457 1772 65.3 Plus
Dmoj\GI15857-PA 554 GI15857-PA 84..344 171..419 214 26.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 00:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11661-PA 531 GL11661-PA 267..531 192..457 1159 79.3 Plus
Dper\GL11661-PA 531 GL11661-PA 1..270 1..274 1133 80.3 Plus
Dper\GL15809-PA 417 GL15809-PA 82..417 109..442 894 46 Plus
Dper\GL13112-PA 512 GL13112-PA 75..342 169..424 226 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 00:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16670-PA 531 GA16670-PA 267..531 192..457 1159 79.3 Plus
Dpse\GA16670-PA 531 GA16670-PA 1..270 1..274 1133 80.3 Plus
Dpse\GA13739-PA 417 GA13739-PA 82..417 109..442 887 46.3 Plus
Dpse\GA23062-PA 512 GA23062-PA 75..342 169..424 226 27 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 00:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18300-PA 537 GM18300-PA 1..274 1..274 1405 97.4 Plus
Dsec\GM18300-PA 537 GM18300-PA 303..537 224..459 1171 89.4 Plus
Dsec\GM23052-PA 281 GM23052-PA 161..281 323..443 437 58.7 Plus
Dsec\GM11357-PA 452 GM11357-PA 61..328 169..424 209 25.3 Plus
Dsec\GM23052-PA 281 GM23052-PA 75..158 113..193 169 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 00:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11832-PA 537 GD11832-PA 1..274 1..274 1414 98.2 Plus
Dsim\GD11832-PA 537 GD11832-PA 303..537 224..459 1172 89.8 Plus
Dsim\GD24693-PA 435 GD24693-PA 103..435 113..443 871 45.5 Plus
Dsim\GD16057-PA 361 GD16057-PA 64..237 253..424 192 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 00:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20434-PA 537 GJ20434-PA 307..537 226..457 1141 87.5 Plus
Dvir\GJ20434-PA 537 GJ20434-PA 1..276 1..274 996 71.7 Plus
Dvir\GJ19255-PA 425 GJ19255-PA 92..425 112..443 829 47.6 Plus
Dvir\GJ19019-PA 439 GJ19019-PA 39..306 169..424 205 25 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 00:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21924-PA 536 GK21924-PA 1..536 1..457 1893 68.7 Plus
Dwil\GK19819-PA 326 GK19819-PA 1..326 120..443 837 46.8 Plus
Dwil\GK10139-PA 552 GK10139-PA 56..323 169..424 205 25.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 00:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14370-PA 537 GE14370-PA 1..274 1..274 1410 97.8 Plus
Dyak\GE14370-PA 537 GE14370-PA 303..537 224..459 1173 89.8 Plus
Dyak\GE17896-PA 407 GE17896-PA 75..407 113..443 868 44.9 Plus
Dyak\GE15443-PA 455 GE15443-PA 64..331 169..424 209 25.3 Plus

RE02778.hyp Sequence

Translation from 78 to 1457

> RE02778.hyp
MIAVLLDIFWIPIGGFLSFLIFISAINKSIGVRKAYVNLLLRIFEYGRVS
IETASKENQHIQNPKTDDKQGVQLVDDADSKEGTNGATLITRDAVLLPQP
QEPAPEKPVSSTKDEINFDFEKCLDYVKSGVEAIIEDDVTSRFEAEELKS
WNMLTRTNRHYEFISWKITSIWVFGFFIRYVILMPLRVLVCFVGVLFAVL
SSSIVACLPFRFVRLSLASLSFKITFRLISSSMSSFIKFHNKQYKPTVSG
FCVANHTSPLDVAILSTDCTYSLIGQRHGGFLGVLQRALARASPHIWFER
GEAKDRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVG
GVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMY
RQEGESAIDFANRVKSVIAKQGGLIDLVWDGQLKRMKPKKEWREIQQVEF
ANRLKSDST*

RE02778.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3209-PC 459 CG3209-PC 1..459 1..459 2393 100 Plus
CG3209-PB 458 CG3209-PB 1..458 1..459 2133 89.3 Plus
CG3209-PD 537 CG3209-PD 1..274 1..274 1398 99.6 Plus
CG3209-PD 537 CG3209-PD 305..537 226..459 1134 90.6 Plus
CG3209-PE 380 CG3209-PE 1..195 1..195 1004 99.5 Plus
CG3209-PE 380 CG3209-PE 195..380 274..459 998 100 Plus
CG15450-PA 407 CG15450-PA 75..407 113..443 848 45.8 Plus