Clone RE03925 Report

Search the DGRC for RE03925

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:39
Well:25
Vector:pFlc-1
Associated Gene/TranscriptPapss-RE
Protein status:RE03925.pep: gold
Sequenced Size:2409

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Papss 2009-06-22 Manual selection by Sue Celniker

Clone Sequence Records

RE03925.complete Sequence

2409 bp assembled on 2009-10-09

GenBank Submission: BT100002.1

> RE03925.complete
TGTTTGCTTTCGACGTTCGTCGCGTGTCTATGACGAAATCCATCCAACTC
GAGCTCGGTTTTCGCGCAATCTGAGTCGAATCCGCATCGCTATCAGTGCT
CAATGTAAAGTAATTAAACCATTAAGGAGAGCTTTACTTCGGAATTACTT
TGACTGGATTTGAGTGCGAAATAAAATATAATAACAATGCCGAATCCGCC
AATTGGATTTTATCCCCATATCAAAAGAAGGTGCCTACAGGTGGCGACGA
ATGTGACCGAGCAAAAGCACCATGTCACCAGGGAGACGCGCGGCAAGAAT
TTGGGACTCTGTCGAGGATTCCGAGGATGCACGGTGTGGCTGACTGGCCT
CAGTGGAGCTGGAAAGACCTCGATTGCCTTCGAACTGGAGGCGTACCTGG
TATCCCGGGGCATTCCGGCCTACGGGTTGGACGGCGACAACATTCGCACC
GGACTGAACAAGAACCTGGGCTTCACGCCCGCCGATCGCGAGGAAAACAT
TCGCCGCGTGGGCGAGGTGGCCAAGTTGTTTGCCGACAGCGGAGTGGTGG
CCATCTGCAGCTTCGTTTCGCCCTTCGCCGACGATCGTGAGATGGCGCGC
AAGATCCACAAGGATGCGGGTCTGAAGTTCTATGAGATATTCGTGGACAC
ACCGCTGGATGTGTGCGAAACCCGGGACGTGAAGGGTCTATACAAGAAGG
CGCGCGAGGGCGTAATCAAAGGATTCACGGGCATTACGCAGGAGTACGAG
CGACCCCAGATGCCGGAGCTGGTGGTCAACACGCACGGCTACACGGTGCG
CGAGTCCACTCAGAAGCTGGTGACGCTGCTCGAACAGGAGGGCATTATTC
CACGCTCGCTGCGCGACGTAGACCTGCTGCCGGAGCTTTATCCCAGCGAA
TCCATTGCCACGGAGGCACTGCGTCACGAGGCCGAGTCGCTGCAAGCCAT
CGAAATCAGCACCGTGGAGCTGCAGTGGGTGCAAGTACTGGCCGAGGGAT
GGGCATATCCACTGCGCGGCTTCATGCGCGAGGATGAGTACCTGCAGACG
CTGCACTTCAACACACTTCAGAGCGGCATGGACGGTTCCTATCGCGAGAA
CCACTCGGTGCCCATTGTTTTGAGCGCCACGCAGGCGGACAAGGATCGTC
TGGACGGCTGCTCCTCGCTGACTCTCAAATACCAAGGCAAGGCGGTAGCC
ATTCTGCGGCGTCCCGAGTTCTACTTTCAGCGTAAGGAGGAGCGGCTGGC
CCGCCAGTTCGGCACCAGCAATCCCAATCACCCGTACAGTAAGCAGGTCT
ACGAGTCCGGGGATTATTTGGTCGGTGGCGATCTGGCAGTGATCGAACGT
ATCCGCTGGGAGGACGGACTGGATCAGTACAGGCTGACTCCCAACGAGTT
AAGGCGCCGCTTTAAGGAGCTGAATGCCGACGCCATCTTCGCCTTTCAGT
TGCGCAATCCCATCCACAACGGCCATGCCCTGCTCATGCAAGACACTCGC
CGCCAGCTGCTGGAGCGCGGCTTCAAGCAGCCAGTGCTGCTGCTGCATCC
TCTGGGTGGCTGGACCAAGGACGACGATGTGCCGCTGGATGTGCGCATGA
AGCAGCACCAGGCCGTGCTCGACGCAGGTGTCTTGCGACGAGAGGACACA
GTGCTGGCCATCTTCCCCTCGCCAATGATGTACGCCGGTCCCACGGAGGT
GCAGTGGCACGCAAAGGCGCGCATGAACGCCGGTGCGAACTTCTACATTG
TAGGCCGTGATCCGGCTGGCATGCCGCATCCGGCCAAGGAAACTTATCCG
GATGGAAACCTATACGATGCCACCCATGGTGCGCGAGTGCTTAAGATGGC
CCAGGGACTAGACAGCATGGAGATCCTGCCCTTCCGTGTTGCTGCCTATG
ACAAGAGCGCCAGTAGAATGGCCTTCTTCGAGCCCAAGAGGAAGGATGAG
TTTGAGTTCATCTCGGGAACCAAGATGCGCACCCTGGCCAAAACGGGAGC
CAGTCCGCCGGATGGCTTCATGGAACCGGAGGCTTGGCGCATCCTGGCCA
CCTACTACCAGAACCTGCCGCAGTCGTAACCCGCTGCTCACACTCGATCC
GCAACGTGCAATTCCTCCTAGTTATAGCTCGTGTGCTTATTATACATAAA
TATTTCAAGCTAAAGGCGCTTACCACTTACCACATCTTTTTTCCATTGTT
CTAAGCCGAAATCCGTGGCTGTCCCCGTGTGTGAATGTTGTGCTCCTCCT
AACTAAATGTTCGTATCGTACAATCTACTTGTATCTACACTTAAGTCACC
CAATTCTTTTTATCTTAAGCAAAATATCGTGCAGCTATTTTGTGGACGGT
TTTTAATACATATATAAATAATAAAATAGAAAATTACTTATCGAAAAAAA
AAAAAAAAA

RE03925.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Papss.e 2675 Papss.e 280..2673 2..2395 11925 99.8 Plus
Papss.a 2464 Papss.a 69..2462 2..2395 11925 99.8 Plus
Papss.b 2658 Papss.b 266..2655 2..2391 11920 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19848178..19849704 346..1872 7575 99.7 Plus
chr3L 24539361 chr3L 19849765..19850285 1871..2391 2605 100 Plus
chr3L 24539361 chr3L 19837532..19837761 2..231 1135 99.6 Plus
chr3L 24539361 chr3L 19847741..19847857 231..347 585 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RH 1893 CG8363-PH 1..1893 187..2079 9450 99.9 Plus
Papss-RF 1893 CG8363-PF 1..1893 187..2079 9450 99.9 Plus
Papss-RE 1893 CG8363-PE 1..1893 187..2079 9450 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RH 2686 CG8363-RH 295..2684 2..2391 11920 99.9 Plus
Papss-RF 2729 CG8363-RF 338..2727 2..2391 11920 99.9 Plus
Papss-RE 2396 CG8363-RE 5..2394 2..2391 11920 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PH 630 CG8363-PH 1..630 187..2076 3310 100 Plus
Papss-PF 630 CG8363-PF 1..630 187..2076 3310 100 Plus
Papss-PE 630 CG8363-PE 1..630 187..2076 3310 100 Plus
Papss-PG 629 CG8363-PG 12..629 223..2076 3223 99.5 Plus
Papss-PB 629 CG8363-PB 12..629 223..2076 3223 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19858814..19860340 346..1872 7620 99.9 Plus
3L 28110227 3L 19860403..19860927 1871..2395 2610 99.8 Plus
3L 28110227 3L 19848169..19848398 2..231 1135 99.6 Plus
3L 28110227 3L 19858377..19858493 231..347 585 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19851914..19853440 346..1872 7620 99.9 Plus
3L 28103327 3L 19853503..19854027 1871..2395 2610 99.8 Plus
3L 28103327 3L 19841269..19841498 2..231 1135 99.5 Plus
3L 28103327 3L 19851477..19851593 231..347 585 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:06:19 has no hits.

RE03925.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:28:09 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19849767..19850242 1873..2348 100 -> Plus
chr3L 19848179..19849704 347..1872 99 -> Plus
chr3L 19847742..19847856 232..346 100 -> Plus
chr3L 19837531..19837761 1..231 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:14:28 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RF 1..1893 187..2079 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:42:29 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RF 1..1893 187..2079 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:32 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RE 1..1893 187..2079 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:09 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RE 1..1893 187..2079 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:14:27 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RF 333..2725 1..2393 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:42:28 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RF 333..2725 1..2393 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:32 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RE 4..2396 1..2393 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:09 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RE 4..2396 1..2393 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:28:09 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19860405..19860925 1873..2393 99   Plus
3L 19858815..19860340 347..1872 99 -> Plus
3L 19858378..19858492 232..346 100 -> Plus
3L 19848168..19848398 1..231 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:32 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19853505..19854025 1873..2393 99   Plus
arm_3L 19851915..19853440 347..1872 99 -> Plus
arm_3L 19851478..19851592 232..346 100 -> Plus
arm_3L 19841268..19841498 1..231 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:23:46 Download gff for RE03925.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19853505..19854025 1873..2393 99   Plus
3L 19851915..19853440 347..1872 99 -> Plus
3L 19851478..19851592 232..346 100 -> Plus
3L 19841268..19841498 1..231 99 -> Plus

RE03925.pep Sequence

Translation from 186 to 2078

> RE03925.pep
MPNPPIGFYPHIKRRCLQVATNVTEQKHHVTRETRGKNLGLCRGFRGCTV
WLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPAD
REENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYE
IFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTH
GYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAE
SLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDG
SYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRK
EERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRL
TPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPV
LLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYA
GPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGAR
VLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTL
AKTGASPPDGFMEPEAWRILATYYQNLPQS*

RE03925.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23598-PA 629 GF23598-PA 12..629 13..630 3217 96.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16064-PA 629 GG16064-PA 12..628 13..629 3277 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14663-PA 629 GH14663-PA 7..629 11..630 3062 90.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PH 630 CG8363-PH 1..630 1..630 3310 100 Plus
Papss-PF 630 CG8363-PF 1..630 1..630 3310 100 Plus
Papss-PE 630 CG8363-PE 1..630 1..630 3310 100 Plus
Papss-PG 629 CG8363-PG 12..629 13..630 3223 99.5 Plus
Papss-PB 629 CG8363-PB 12..629 13..630 3223 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11647-PA 629 GI11647-PA 12..629 13..630 3059 90.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15741-PA 625 GL15741-PA 12..625 13..630 3042 91.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21020-PA 629 GA21020-PA 12..629 13..630 3120 93.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19669-PA 533 GM19669-PA 92..487 15..410 2095 99.2 Plus
Dsec\GM19674-PA 77 GM19674-PA 1..77 554..630 409 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14833-PA 595 GD14833-PA 12..595 13..630 3069 93.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11328-PA 630 GJ11328-PA 1..630 1..630 3147 91.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16974-PA 658 GK16974-PA 44..658 16..630 3123 93.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19629-PA 630 GE19629-PA 1..629 1..629 3385 99.8 Plus
Dyak\GE19630-PA 315 GE19630-PA 20..314 335..629 1589 99.7 Plus

RE03925.hyp Sequence

Translation from 186 to 2078

> RE03925.hyp
MPNPPIGFYPHIKRRCLQVATNVTEQKHHVTRETRGKNLGLCRGFRGCTV
WLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPAD
REENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYE
IFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTH
GYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAE
SLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDG
SYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRK
EERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRL
TPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPV
LLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYA
GPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGAR
VLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTL
AKTGASPPDGFMEPEAWRILATYYQNLPQS*

RE03925.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PH 630 CG8363-PH 1..630 1..630 3310 100 Plus
Papss-PF 630 CG8363-PF 1..630 1..630 3310 100 Plus
Papss-PE 630 CG8363-PE 1..630 1..630 3310 100 Plus
Papss-PG 629 CG8363-PG 12..629 13..630 3223 99.5 Plus
Papss-PB 629 CG8363-PB 12..629 13..630 3223 99.5 Plus