Clone RE04053 Report

Search the DGRC for RE04053

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:40
Well:53
Vector:pFlc-1
Associated Gene/TranscriptUpf2-RA
Protein status:RE04053.pep: gold
Sequenced Size:5070

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2253 2005-08-12 Manual selection by Sue Celniker
Upf2 2008-04-29 Release 5.5 accounting
Upf2 2008-08-15 Release 5.9 accounting
Upf2 2008-12-18 5.12 accounting

Clone Sequence Records

RE04053.complete Sequence

5070 bp (5070 high quality bases) assembled on 2005-11-03

GenBank Submission: BT024221

> RE04053.complete
TGGGATGTAAATCGTGGCGGAAAAACGTGGGAAAAACAAAGCAATGACAG
TTATTTAAAGAACATAATATCAAATATATAATTCGTCCGAACAGTTCCAG
CAACTGATCAACCTAAGGTGACTATTTCACATTAAAAACTATGCCCAATC
ACACTCAGCCTTAGCTCTCCAAGAACAAAATAGTTCCCGATTCGCATACC
TTTGCCAGCAGGTCCAGTTTCAAAACATAGCCACCGCGCATCAAGTCGCG
CCAACGTGAATCCGTTCACGGAACTTCCACCAACGCCATGCTAGCCAACG
ATTCTGCAACGACTGACAGCGAGGTGTCCACACCGCCGTCGTCGAGGAAA
GATTTGGCAGATGGTGTTGCCGAGGGTGACAACGACAACGACATCGATAC
CGGCGACACGGACGCAAATGCGGATGAAGATGTGGATGCGGCTGCTGCCA
TTGCCCTGGAGGCCGAAGAGCGCGAGGAGCTGCAACAGTTCATAAGCGAG
CTGCGCGAGAAGATCGAGAGCAAGCGACAGCTGCGCCTCCAAAACTCCAC
AATCGAGCTGCCCGGTGAGGAGTACTTCGCCAAACTGGACTCCAATCTCA
AAAAGAACACGGCATTCGTCAAGAAACTGAAACTATTCACGGCCACACAG
CTGGACGGACTATTGCGTGAGATATCTGCTCTAAACCTGAGCAAATACAT
CTCGGAAATATGCGCCGCGCTGGTCGAGGCCAAACTGAAAATGACTGATG
TGCCGGCGGTGGTGACGCTGGCCTCTCGGCTGCACTGCACATATGCCGAC
TTCGATGTCCATTTTCTGGAGGCCTGGCAAAAGGCACTGAACATCAAGGC
CACCGAGAAGATTGGCAATCCGAGCAAACTGCGCGTGGATCTTCGCCTGT
TCGCCGAACTAGTCAGCTCTGGTGTGATCCAAATGAAGCCCGGATTGGCC
CAACTGGGTGTTGTTCTGGTGCATTTGATTGCCCTGGACAAGGATGACCA
CAGCAACTTCTCGATCATCCTCTCATTCTGCCGGCACTGCGGCGAGGAGT
ACGCCGGCCTAGTGCCGCAAAAGATGCAACAGTTGGCCACCAAATACGGG
GTGGAGGTGCCGAAATCCGACTTCCTGACTGCCGACAAGCAGCTCAATCT
GCGCACCATGCTTAAGGGTTACTTCAAGGCCCTGTGCAAGCATGTCCTGG
CCGAGCAGGCCGAACTGATGAACATGACCAAGAACATTCGGCGCACCATG
GAGTGCAAGGGTGAGATATCCACGGAGAAGCGCGAGAAGTGTGAACTGAT
GCAGGCCGGATTCGATAAGCTGCTGGCCTCCGCTCAATCGCTGTCGGAAC
TGCTGGGTGAACCACTGCCCGAGCTGGCCAAGGAGTCTGAGGGCTGTAAT
CCGGGCACAGTCATCGACAACATGCTGGACAGTGCCTCCTTTGGTGTGCT
GGATCCGTGGGGCGACGAGGAGACCCGAGCCTTCTACACGGATTTGCCCG
ATTTGAGACAGTTTCTGCCAAACTTTTCGGCACCCAAAGTCGATTTGGAA
ACGTTAGAGGAGCCCAGTGAACTAACCGAAGAAGCGATCGATGCCAATCT
AGATGCCGAAATGGATCTAGATGATCCACCGTCCACCACTTCGGATACGA
CTCCGGAGAATCCAATCGAAGAGCAGCCAACGACGCCAGTTGCCGCTGCG
GAGGATCTCAAGCCGCAGAAGATGGGTAACGCTCTAATGGAACTGGGTCG
CCAGCAGCAGCAGCAAAGTCAGCTCAACCAGAATCCGATCCAGATCCAAA
ACCAGATGCGTCAGCAGTTCGATGGCTTCCTGGTCAACCTATTCAACTGT
GTGAACAAGGAGCTGATCGATTCGGCGGCCATCGAGTTCCTGCTTAACTT
CAATACCAAGCATCAACGCAAGAAGCTGACGCGTACGATATTCTCGGTGC
AGCGTACGCGTCTGGATATCCTGCCCTATCTCTCCCGCTTCGTGGCCATT
GTGCATATGTGCAATACCGATGTGGCCACCGATTTGGCCGAACTGCTGCG
CAAGGAGTTCAAGTGGCACATTCACAAGAAGAACCAGCTGAATATCGAGA
CGAAGCTTAAGATTGTGCGATTCATTGGTGAACTGGTTAAGTTTGGTTTG
TTTAAAAAGTTCGATGCCTTAGGATGTCTGAAGATGCTGCTAAGGGACTT
TCAGCATCATCAAATCGAGATGGCCTGTGCCTTTGTGGAAGTCACCGGCG
TCTATCTGTACAATTGCCGGGATGCCCGTCTGCTGATGAATGTGTTCCTG
GACCAGATGCTGCGCTTGAAAACAGCCACGGCAATGGACTCGCGACATGC
GGCGCAGATTGAGAGCGTGTACTATTTGGTAAAGCCGCCGGAATCGTCCA
AGCGAGAGCCCATGGTTCGGCCGGCAATGCATGAGTACATCCGTTACTTG
ATCTTCGAGGAGCTTTGCAAACAGAACGTTGATCGTTGTATCAAAATGCT
GCGCCGCATCGATTGGCAGGATCCGGAGACAAATTGTTATGCCATTAAGT
GCCTCAGCAAGGCGTATCTGCTGCGCTTCCAGCTCATCCGCTGTCTGGCC
GATCTCGTATCCGGACTGAGCTCCTATCAGCCACGAGCGGTTACCATCGT
GATCGATAATGTGTTTGAGGATATACGCGCTGGCCTCGAGATTCATTCGC
CACGCATGGCACAGCGGCGCATCGCGATGGCCAAGTATCTGGGCGAGATG
TACAACTACAAGCTGGTGGAGTCCACGAACATTCTTAATACGCTGTACTC
CATCATCTCGCTGGGCGTATCGAATGACCAAAATGTCGTCTCGCCACTGG
ATCCGCCCGATAGCCTGTTCCGACTGAAGCTTGCCTGTATGCTACTGGAC
ACGTGTGCACCCTACTTCACCAGCCAGGCCACGCGAAAAAAACTGGACTA
CTTTCTGGTCTTCTTCCAACACTACTATTGGTTCAAGAAATCCCATCCCG
TGTTCAGCAAAACGGAGAACACCTCCGATTTGTTCCCCATCCTAATGGAT
CACACCTATCGCGACTGTCTACTCAATGTGCGGCCCAAGCTGAAGATTTA
CAAGAGTCTAGAGCAGGCCAAGGCGGCGATTGATCATCTGCAGGAGAAGC
TCTATCCGCAGCTAAAGACTACCAATAATGCTCAGGATCCGTCGCTGGGC
ACAATCAGTGAAATAAGCGAGATAGACGAGGGCGGCACTGATGAGGATTC
TGGGTCATCGAATGATCAGCGAGAGCGCCAAGTGTCGGGCCAAGAGCAGG
ACCAGAGCAACGACTGGACAGAGAACGAGGCGGAGCCACCGCTGCCGCCG
CTCCCGCCGCCAGAAAAGTCCAAGGAGGACCTGGAGTTCGAGCAATTGTA
CGAAAAAATGACCACAGACTCGTACCAAGAACGGCTTAAGGAGCCGATAA
AGGCTACGGCCAAGGATATACCTGTGCCGATGATGGCGCGCCTGCAAAAA
AAATCGTACGATCAGATAACAGGTGCTCAGACCATCGGCCCTGGGATCAA
CAATATGTCACAGATCTCAAAGTCGGTCCCCAATCAGGACGGAACGCCTG
GCTCTCCAGGTGCAGATTCACCAGATGGCAACGGCAAATCCGGCGGCGGT
GTAGGTGGTAGCGATGTTGGTGCTGCTGGTGCTGCTGGTGCTTCTGGTGC
TACATCTGTACCCTTTGTGCTAATGGTGCGCGGCCACAAGGGCGGAAAGC
AGCAATTTAAGTCATTTGTGGCACCATCCGACTCGCACTTGGCCACCAAC
CTAAAGCGGCAGGAGCAGATGATACGCGAGGAGAAGGAGAAGGTCAAGCG
CCTTACGCTTAACATAACTGAGCGCATTGAGGAGGAGGACTACCAGGAGT
CGTTGATGCCGCCGCAGCATCGAAACTTCACCCAGAGCTACTACCAGAAG
CCCAATAAGCACAAGTTCAAGCACCAAAAGGGTGCGCCCGATGCGGACCT
CATATTTCACTGAAACGTTGCCCCCGCTAACGGATCCGAAAACAGCCGGT
GCCGGTGAGTGCGGTAGCTCGCTGGTTTTTTAGGTGACAGCCACTTGTGC
GTTTCCCAGCCTCCTTCTGGCCGTCGTATTAATACCACTGTGCTGTTGCT
GTTGCTGCTGCTGCTGCAGCTGCAGCTGCTGTAAGGCCTAAAGACTGCGA
TTGCGATACCACGGAAGCGAAATAATACGATGCGGAGAGTAACGCTCCAA
GAGCCAACGACTCTCCGCCAACGGAAGAAGCTCCGGAAATTGCGCGATCC
CAAACACAAGAGACACACCAACCTCAAGCTGTACTTAAGTCAAACAATTC
ACAAAACAACAGGCCAACATGTTAAGCCAGCCACTCAATCCAAACCAATC
CAAGCCAACCAATATACAACAACAGGCCAACATGCCAACATACTAACATA
CCAAGCCACTCAATCGCAGTCGTGGCAGCTGAAGCCCATCCAAATGGACC
CTGGGACCTCGTCCTCGATATTATCGTGTATATATGTAGAAGTGCTGCTA
CGATCCCGATCCGTAAACGTATATTTTAACACTACTTAGTACGTAAAAAT
GCCTAGACTTGTTTCGAAAACACAACCCAATTGAATAACAAAGCATATAT
ACAACGATATATACAGATTGTTATATAATGTTACATACACACACACACAC
ACACACACACACGCATTCGATAATGCCATCCGATGATCCATTCACATTTT
TGAATCAAATGCAGAATGCAGTCGGAAGTGAATTCGTCTCCATTGGGAAA
GCTGTTTGGATGAGCAAATGGAAAGATCCCCCGCCACTGAGTTTCTTCTG
GGGATGCAGTGAGTCCAGCAAGTCTCGAACTTAGCTCGCTTGTGTATTGG
AGTTTTAATTGAATAATTCTCGGATGCCCTTTTGCATTGATGCTAGGTAC
TTTATCTCATGTTGTATAAGAAATAATAACTTGTAAACAATTGATCCAAA
TTTCTGTACTCAAATTTCGCATTATTTCCATCCGATGAATAAATAAGATA
CACGAAAAAAAAAAAAAAAA

RE04053.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-RA 5108 Upf2-RA 55..5107 5..5057 25265 100 Plus
Upf2.a 5021 Upf2.a 149..5021 182..5054 24365 100 Plus
Upf2.a 5021 Upf2.a 38..150 5..117 565 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7964332..7967268 2941..5 14505 99.6 Minus
chrX 22417052 chrX 7962076..7963894 5054..3234 8665 98.5 Minus
chrX 22417052 chrX 7963958..7964250 3234..2942 1465 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-RA 3726 CG2253-PA 1..3726 288..4013 18630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:27:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-RA 5078 CG2253-RA 29..5078 5..5054 25250 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-PA 1241 CG2253-PA 1..1241 288..4010 5563 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8072502..8075438 2941..5 14685 100 Minus
X 23542271 X 8070241..8072064 5057..3234 9120 100 Minus
X 23542271 X 8072128..8072420 3234..2942 1465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8080600..8083536 2941..5 14685 100 Minus
X 23527363 X 8078339..8080162 5057..3234 9120 100 Minus
X 23527363 X 8080226..8080518 3234..2942 1465 100 Minus
Blast to na_te.dros performed 2014-11-27 13:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1526..1587 3709..3648 121 66.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6845..6913 1752..1817 121 68.1 Plus

RE04053.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:59:25 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7964332..7967270 1..2941 99   Minus
chrX 7963959..7964250 2942..3233 100 <- Minus
chrX 7962076..7963894 3234..5054 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:48:08 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 1..3726 288..4013 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:49 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 1..3726 288..4013 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:11 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 1..3726 288..4013 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:20:12 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 1..3726 288..4013 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:59:25 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 1..3726 288..4013 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:47:57 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 34..4046 1..4013 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:49 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 34..5087 1..5054 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:11 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 25..5078 1..5054 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:20:13 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 34..4046 1..4013 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:59:25 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
Upf2-RA 25..5078 1..5054 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:59:25 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
X 8072502..8075440 1..2941 99   Minus
X 8072129..8072420 2942..3233 100 <- Minus
X 8070244..8072064 3234..5054 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:11 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7966535..7969473 1..2941 99   Minus
arm_X 7966162..7966453 2942..3233 100 <- Minus
arm_X 7964277..7966097 3234..5054 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:55:12 Download gff for RE04053.complete
Subject Subject Range Query Range Percent Splice Strand
X 8080600..8083538 1..2941 99   Minus
X 8080227..8080518 2942..3233 100 <- Minus
X 8078342..8080162 3234..5054 100 <- Minus

RE04053.pep Sequence

Translation from 287 to 4012

> RE04053.pep
MLANDSATTDSEVSTPPSSRKDLADGVAEGDNDNDIDTGDTDANADEDVD
AAAAIALEAEEREELQQFISELREKIESKRQLRLQNSTIELPGEEYFAKL
DSNLKKNTAFVKKLKLFTATQLDGLLREISALNLSKYISEICAALVEAKL
KMTDVPAVVTLASRLHCTYADFDVHFLEAWQKALNIKATEKIGNPSKLRV
DLRLFAELVSSGVIQMKPGLAQLGVVLVHLIALDKDDHSNFSIILSFCRH
CGEEYAGLVPQKMQQLATKYGVEVPKSDFLTADKQLNLRTMLKGYFKALC
KHVLAEQAELMNMTKNIRRTMECKGEISTEKREKCELMQAGFDKLLASAQ
SLSELLGEPLPELAKESEGCNPGTVIDNMLDSASFGVLDPWGDEETRAFY
TDLPDLRQFLPNFSAPKVDLETLEEPSELTEEAIDANLDAEMDLDDPPST
TSDTTPENPIEEQPTTPVAAAEDLKPQKMGNALMELGRQQQQQSQLNQNP
IQIQNQMRQQFDGFLVNLFNCVNKELIDSAAIEFLLNFNTKHQRKKLTRT
IFSVQRTRLDILPYLSRFVAIVHMCNTDVATDLAELLRKEFKWHIHKKNQ
LNIETKLKIVRFIGELVKFGLFKKFDALGCLKMLLRDFQHHQIEMACAFV
EVTGVYLYNCRDARLLMNVFLDQMLRLKTATAMDSRHAAQIESVYYLVKP
PESSKREPMVRPAMHEYIRYLIFEELCKQNVDRCIKMLRRIDWQDPETNC
YAIKCLSKAYLLRFQLIRCLADLVSGLSSYQPRAVTIVIDNVFEDIRAGL
EIHSPRMAQRRIAMAKYLGEMYNYKLVESTNILNTLYSIISLGVSNDQNV
VSPLDPPDSLFRLKLACMLLDTCAPYFTSQATRKKLDYFLVFFQHYYWFK
KSHPVFSKTENTSDLFPILMDHTYRDCLLNVRPKLKIYKSLEQAKAAIDH
LQEKLYPQLKTTNNAQDPSLGTISEISEIDEGGTDEDSGSSNDQRERQVS
GQEQDQSNDWTENEAEPPLPPLPPPEKSKEDLEFEQLYEKMTTDSYQERL
KEPIKATAKDIPVPMMARLQKKSYDQITGAQTIGPGINNMSQISKSVPNQ
DGTPGSPGADSPDGNGKSGGGVGGSDVGAAGAAGASGATSVPFVLMVRGH
KGGKQQFKSFVAPSDSHLATNLKRQEQMIREEKEKVKRLTLNITERIEEE
DYQESLMPPQHRNFTQSYYQKPNKHKFKHQKGAPDADLIFH*

RE04053.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 13:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20988-PA 1258 GF20988-PA 36..1258 13..1241 5317 82.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 13:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17588-PA 1249 GG17588-PA 1..1249 1..1241 5731 89.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 13:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24090-PA 1353 GH24090-PA 588..1353 507..1241 3038 75.9 Plus
Dgri\GH24090-PA 1353 GH24090-PA 78..527 65..488 1907 82 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-PA 1241 CG2253-PA 1..1241 1..1241 6404 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 13:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15289-PA 830 GI15289-PA 452..830 866..1241 1298 71.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 13:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26901-PA 1133 GL26901-PA 76..1133 179..1241 4543 82.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 13:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15324-PA 1227 GA15324-PA 56..1227 65..1241 4985 81.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 13:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11217-PA 1237 GM11217-PA 1..1237 1..1241 6199 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 13:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16133-PA 1237 GD16133-PA 1..1237 1..1241 6089 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 13:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16435-PA 1268 GJ16435-PA 57..1268 57..1241 4986 81 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 13:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25276-PA 1249 GK25276-PA 3..1249 5..1241 4935 76.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 13:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17488-PA 1260 GE17488-PA 1..1260 1..1241 5894 90.7 Plus

RE04053.hyp Sequence

Translation from 287 to 4012

> RE04053.hyp
MLANDSATTDSEVSTPPSSRKDLADGVAEGDNDNDIDTGDTDANADEDVD
AAAAIALEAEEREELQQFISELREKIESKRQLRLQNSTIELPGEEYFAKL
DSNLKKNTAFVKKLKLFTATQLDGLLREISALNLSKYISEICAALVEAKL
KMTDVPAVVTLASRLHCTYADFDVHFLEAWQKALNIKATEKIGNPSKLRV
DLRLFAELVSSGVIQMKPGLAQLGVVLVHLIALDKDDHSNFSIILSFCRH
CGEEYAGLVPQKMQQLATKYGVEVPKSDFLTADKQLNLRTMLKGYFKALC
KHVLAEQAELMNMTKNIRRTMECKGEISTEKREKCELMQAGFDKLLASAQ
SLSELLGEPLPELAKESEGCNPGTVIDNMLDSASFGVLDPWGDEETRAFY
TDLPDLRQFLPNFSAPKVDLETLEEPSELTEEAIDANLDAEMDLDDPPST
TSDTTPENPIEEQPTTPVAAAEDLKPQKMGNALMELGRQQQQQSQLNQNP
IQIQNQMRQQFDGFLVNLFNCVNKELIDSAAIEFLLNFNTKHQRKKLTRT
IFSVQRTRLDILPYLSRFVAIVHMCNTDVATDLAELLRKEFKWHIHKKNQ
LNIETKLKIVRFIGELVKFGLFKKFDALGCLKMLLRDFQHHQIEMACAFV
EVTGVYLYNCRDARLLMNVFLDQMLRLKTATAMDSRHAAQIESVYYLVKP
PESSKREPMVRPAMHEYIRYLIFEELCKQNVDRCIKMLRRIDWQDPETNC
YAIKCLSKAYLLRFQLIRCLADLVSGLSSYQPRAVTIVIDNVFEDIRAGL
EIHSPRMAQRRIAMAKYLGEMYNYKLVESTNILNTLYSIISLGVSNDQNV
VSPLDPPDSLFRLKLACMLLDTCAPYFTSQATRKKLDYFLVFFQHYYWFK
KSHPVFSKTENTSDLFPILMDHTYRDCLLNVRPKLKIYKSLEQAKAAIDH
LQEKLYPQLKTTNNAQDPSLGTISEISEIDEGGTDEDSGSSNDQRERQVS
GQEQDQSNDWTENEAEPPLPPLPPPEKSKEDLEFEQLYEKMTTDSYQERL
KEPIKATAKDIPVPMMARLQKKSYDQITGAQTIGPGINNMSQISKSVPNQ
DGTPGSPGADSPDGNGKSGGGVGGSDVGAAGAAGASGATSVPFVLMVRGH
KGGKQQFKSFVAPSDSHLATNLKRQEQMIREEKEKVKRLTLNITERIEEE
DYQESLMPPQHRNFTQSYYQKPNKHKFKHQKGAPDADLIFH*

RE04053.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Upf2-PA 1241 CG2253-PA 1..1241 1..1241 6404 100 Plus