Clone RE05515 Report

Search the DGRC for RE05515

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:55
Well:15
Vector:pFlc-1
Associated Gene/Transcriptbl-RC
Protein status:RE05515.pep: gold
Sequenced Size:2115

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
bl-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE05515.complete Sequence

2115 bp assembled on 2009-10-14

GenBank Submission: BT100100.1

> RE05515.complete
ATTTTAACTCAGCTCTAGTGTGTTTGTGCTATACATATTTTGAATAATAT
TTTACCAGCCAGTGTTTAGTGGCGGACAAAATCGTGTTGAATACCAATTG
AAAGTTAAGTGATTAAGTTCGGTGGCATCAAAGTCTTCGTAGCTGAAGGA
AAACAAAGGCATCCCGATAGCTGATTTATCGAGGTTTGCAATTTGTCATC
GTTAAATAAAGAACATGACAAAGAGACTGAGAATGAAGCGTGAAATGAAC
GATGAAGGGGAGGGACCACAGGACCAGAAGCGCAATCGCCGCAACGAGGA
GACCGTTCGCATACTGATTCCGAGCAGTATTGCTGGGGCTGTCATTGGCA
AAGGAGGACAGCACATTCAGAAGATGAGGACTCAGTATAAAGCCACTGTG
TCTGTCGACGATTCCCAAGGCCCCGAACGAACCATCCAAATATCGGCGGA
TATAGAGTCCACATTGGAGATTATCACCGAAATGCTGAAATACTTTGAGG
AGCGCGACGAGGACTTTGATGTGCGTCTACTTATACACCAGAGCTTGGCC
GGCTGCGTCATTGGCAAAGGTGGACAAAAGATCAAGGAGATCCGCGATCG
CATCGGCTGCCGCTTTTTGAAGGTCTTCTCGAATGTGGCACCACAGAGCA
CAGATCGAGTGGTGCAGACCGTTGGCAAGCAGAGCCAGGTCATCGAAGCG
GTTCGTGAGGTGATCACACTTACACGGGACACTCCCATCAAGGGGGCGAT
ACATAACTATGATCCTATGAACTTTGACCGCGTATATGCCGATGAGTACG
GTGGCTATGGCACTGGAAGTGGCAGTACCCGTCCAAGTCAGCGGGGAAAC
AATCGTAACGGAGGAGGCGCTGGAGGTGTTGCCGGCGGCGCAGCCGGTGG
CAATGGTGGAGGATTCAATGCTGGCGGTGCACGCGGCAATGCTGGCGGAC
GTGGCGGAGCTGATCGCTTTGGCGGCGCCGCTGGTGGAGCTGTGGCCGGT
GCTGGAATGGGGCAGCGCGACAATCCGTTCATTAATCCGTGGGCCAATGG
CGGTGGCGGTGATGTAGATGGTTTTGGCAACAACGCTGGTGGTGCTGGTG
GATTTGCCGGTAACAGCTTTGGCGGTGGCGCCGGTGGACCATTCGGAGGT
GGTAGCTTTGGCAACAACGGTTTCGGAGGTGGACCCAGCGACTTTGGCGG
AAATTCCGGAAACTTTGGACAGGCCCAGGGCACTAACAGTCTGCCAAGCC
TTGGTAGCTTCAGCCAGAACCAGGGTGGCACTAGCAGCCTGCCCAGCTTG
GGCAGCTTTGGTCAGAATCCAGGCGGACCCGGTGGATTGGGTAACGGACT
GAGTGGCGGTGCTAATGGCGGCGTTGGAACCCTGGGTGGTGCTAATGGAG
CCGGTGGCTTTAATGCTGTCGGTGGAGCTAACGGTGGGCCGAATGGCAGC
CCAAATGCCGCGACAAATGTGCCTCAGGGTCATGATCCCAACAACAGCAC
ACAGGTCACCATTCCAAAAGAGCTGGCTGGTGCCATCATTGGTAAGGGAG
GTGGCCGCATCCGTCGCATCCGCAACGAGTCCAGTGCGTACATCACCATC
GACGAGCCCCTGCCAAACTCGAACGATCGTATCATCACCATCTCGGGCAC
GCCGAAGCAAATACAAATGGCCCAGTATCTGCTGCAACAGAGCGTACACG
AGAATGGCAGGCGAAACATTTAAGTGGGCAAGGACTTGAACAGCTACAAC
AGCAATAGCAACACCATTCGACAAAACAACAAATTCAACAACTACAATAA
CCATCGAGAATTGCTGCGTTTCACGTTTAAATTTAAATGTACTAAAAGGA
AGAACTGGCGAACGCCCAGGGCAAGAGAGCATCCTCCAAATACGAAAGAA
ATTTATGTATTTCTTCACTAAATTTAAGTGAATATTATACGCCCCAAATG
GATAAGAAACTGGAACCGAGTTGCCCCAACCATCAGCGCCTGCATCCCCC
CATTCATCCTCGTCGTCACCAGTTTGCAATTTGGGGGAAAGTCAACATTA
AAACTCTGTATGATAAGAAGAATGAACAAATAAAGTAAACATAAACTTGA
AAAAAAAAAAAAAAA

RE05515.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
bl-RC 2173 bl-RC 71..2170 1..2100 10500 100 Plus
bl-RB 2129 bl-RB 455..2126 429..2100 8360 100 Plus
bl-RE 2236 bl-RE 241..1711 222..1692 7355 100 Plus
bl-RE 2236 bl-RE 1733..2144 1689..2100 2045 99.7 Plus
bl-RB 2129 bl-RB 71..455 1..385 1925 100 Plus
bl-RE 2236 bl-RE 71..240 1..170 850 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16491419..16492346 599..1526 4625 99.9 Plus
chr2R 21145070 chr2R 16493174..16493582 1691..2099 2030 99.8 Plus
chr2R 21145070 chr2R 16492403..16492574 1521..1692 860 100 Plus
chr2R 21145070 chr2R 16474331..16474504 1..174 840 98.9 Plus
chr2R 21145070 chr2R 16482300..16482406 222..328 520 99.1 Plus
chr2R 21145070 chr2R 16485338..16485435 501..598 475 99 Plus
chr2R 21145070 chr2R 16485193..16485266 429..502 370 100 Plus
chr2R 21145070 chr2R 16482501..16482557 329..385 285 100 Plus
chr2R 21145070 chr2R 16476369..16476421 169..221 265 100 Plus
chr2R 21145070 chr2R 16484274..16484320 383..429 235 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
bl-RC 1509 CG13425-PC 1..1509 215..1723 7545 100 Plus
bl-RF 1491 CG13425-PF 1..1491 233..1723 7455 100 Plus
bl-RA 1491 CG13425-PA 1..1491 233..1723 7455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:28:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
bl-RC 2127 CG13425-RC 25..2123 1..2099 10495 100 Plus
bl-RF 2078 CG13425-RF 197..2074 222..2099 9390 100 Plus
bl-RA 2076 CG13425-RA 195..2072 222..2099 9390 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
bl-PC 502 CG13425-PC 1..502 215..1720 1385 100 Plus
bl-PF 496 CG13425-PF 1..496 233..1720 1356 100 Plus
bl-PA 496 CG13425-PA 1..496 233..1720 1356 100 Plus
bl-PE 493 CG13425-PE 1..486 233..1690 1303 100 Plus
bl-PB 413 CG13425-PB 1..413 482..1720 941 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20604696..20605623 599..1526 4625 99.9 Plus
2R 25286936 2R 20606442..20606851 1691..2100 2050 100 Plus
2R 25286936 2R 20605680..20605851 1521..1692 860 100 Plus
2R 25286936 2R 20587575..20587748 1..174 855 99.4 Plus
2R 25286936 2R 20595557..20595663 222..328 535 100 Plus
2R 25286936 2R 20598597..20598694 501..598 490 100 Plus
2R 25286936 2R 20598452..20598525 429..502 370 100 Plus
2R 25286936 2R 20595758..20595814 329..385 285 100 Plus
2R 25286936 2R 20589615..20589667 169..221 265 100 Plus
2R 25286936 2R 20597545..20597591 383..429 235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20605895..20606822 599..1526 4625 99.8 Plus
2R 25260384 2R 20607641..20608050 1691..2100 2050 100 Plus
2R 25260384 2R 20606879..20607050 1521..1692 860 100 Plus
2R 25260384 2R 20588774..20588947 1..174 855 99.4 Plus
2R 25260384 2R 20596756..20596862 222..328 535 100 Plus
2R 25260384 2R 20599796..20599893 501..598 490 100 Plus
2R 25260384 2R 20599651..20599724 429..502 370 100 Plus
2R 25260384 2R 20596957..20597013 329..385 285 100 Plus
2R 25260384 2R 20590814..20590866 169..221 265 100 Plus
2R 25260384 2R 20598744..20598790 383..429 235 100 Plus
Blast to na_te.dros performed 2014-11-27 04:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
aurora-element 4263 aurora-element DMAURA 4263bp Derived from AB022762 (d1268008) (Rel. 59, Last updated, Version 1). 3655..3701 1343..1297 127 74.5 Minus
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 687..763 113..36 126 64.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2760..2824 1730..1796 123 69.1 Plus

RE05515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:11:25 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16493285..16493582 1802..2099 99   Plus
chr2R 16493176..16493221 1693..1738 100 == Plus
chr2R 16492405..16492574 1523..1692 100 -> Plus
chr2R 16491419..16492342 599..1522 100 -> Plus
chr2R 16485340..16485435 503..598 98 -> Plus
chr2R 16485194..16485266 430..502 100 -> Plus
chr2R 16484277..16484320 386..429 100 -> Plus
chr2R 16482501..16482557 329..385 100 -> Plus
chr2R 16482300..16482406 222..328 99 -> Plus
chr2R 16476371..16476421 171..221 100 -> Plus
chr2R 16474331..16474500 1..170 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:15:55 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 1..1509 215..1723 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:57 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 1..1509 215..1723 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:33 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 1..1509 215..1723 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:11:25 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 1..1509 215..1723 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:15:54 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 71..2169 1..2099 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:57 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 71..2169 1..2099 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:33 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 25..2123 1..2099 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:11:25 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 25..2123 1..2099 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:11:25 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20606444..20606850 1693..2099 100   Plus
2R 20605682..20605851 1523..1692 100 -> Plus
2R 20604696..20605619 599..1522 100 -> Plus
2R 20598599..20598694 503..598 100 -> Plus
2R 20598453..20598525 430..502 100 -> Plus
2R 20597548..20597591 386..429 100 -> Plus
2R 20595758..20595814 329..385 100 -> Plus
2R 20595557..20595663 222..328 100 -> Plus
2R 20589617..20589667 171..221 100 -> Plus
2R 20587575..20587744 1..170 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:33 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16493949..16494355 1693..2099 100   Plus
arm_2R 16493187..16493356 1523..1692 100 -> Plus
arm_2R 16492201..16493124 599..1522 100 -> Plus
arm_2R 16486104..16486199 503..598 100 -> Plus
arm_2R 16485958..16486030 430..502 100 -> Plus
arm_2R 16485053..16485096 386..429 100 -> Plus
arm_2R 16483263..16483319 329..385 100 -> Plus
arm_2R 16483062..16483168 222..328 100 -> Plus
arm_2R 16477122..16477172 171..221 100 -> Plus
arm_2R 16475080..16475249 1..170 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:29 Download gff for RE05515.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20607643..20608049 1693..2099 100   Plus
2R 20606881..20607050 1523..1692 100 -> Plus
2R 20605895..20606818 599..1522 100 -> Plus
2R 20599798..20599893 503..598 100 -> Plus
2R 20599652..20599724 430..502 100 -> Plus
2R 20598747..20598790 386..429 100 -> Plus
2R 20596957..20597013 329..385 100 -> Plus
2R 20596756..20596862 222..328 100 -> Plus
2R 20590816..20590866 171..221 100 -> Plus
2R 20588774..20588943 1..170 100 -> Plus

RE05515.pep Sequence

Translation from 214 to 1722

> RE05515.pep
MTKRLRMKREMNDEGEGPQDQKRNRRNEETVRILIPSSIAGAVIGKGGQH
IQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEMLKYFEERDED
FDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVV
QTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFDRVYADEYGGYGT
GSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGAD
RFGGAAGGAVAGAGMGQRDNPFINPWANGGGGDVDGFGNNAGGAGGFAGN
SFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFS
QNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFN
AVGGANGGPNGSPNAATNVPQGHDPNNSTQVTIPKELAGAIIGKGGGRIR
RIRNESSAYITIDEPLPNSNDRIITISGTPKQIQMAQYLLQQSVHENGRR
NI*

RE05515.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12183-PA 511 GF12183-PA 1..511 7..502 1512 84 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22043-PA 498 GG22043-PA 1..498 7..502 1540 93.6 Plus
Dere\GG16232-PA 364 GG16232-PA 25..189 30..184 222 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21981-PA 512 GH21981-PA 1..203 7..210 977 94.1 Plus
Dgri\GH14429-PA 362 GH14429-PA 25..189 30..184 221 30.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
bl-PC 502 CG13425-PC 1..502 1..502 2644 100 Plus
bl-PF 496 CG13425-PF 1..496 7..502 2615 100 Plus
bl-PA 496 CG13425-PA 1..496 7..502 2615 100 Plus
bl-PE 493 CG13425-PE 1..486 7..492 2562 100 Plus
bl-PB 413 CG13425-PB 1..413 90..502 2200 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19683-PA 509 GI19683-PA 1..202 7..209 986 95.6 Plus
Dmoj\GI13561-PA 362 GI13561-PA 25..189 30..184 220 30.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17034-PA 506 GL17034-PA 1..506 7..502 1430 78.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24337-PA 505 GA24337-PA 1..280 7..278 1031 84.3 Plus
Dpse\GA20351-PA 330 GA20351-PA 25..178 30..173 197 29 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22026-PA 345 GM22026-PA 1..280 7..281 1031 94.6 Plus
Dsec\GM22027-PA 63 GM22027-PA 1..58 437..494 288 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11524-PA 496 GD11524-PA 1..496 7..502 2491 99.2 Plus
Dsim\GD17651-PA 213 GD17651-PA 3..137 60..184 174 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17213-PA 511 GJ17213-PA 1..276 7..278 992 83.4 Plus
Dvir\GJ19833-PA 315 GJ19833-PA 1..120 90..209 578 94.2 Plus
Dvir\GJ11921-PA 589 GJ11921-PA 25..189 30..184 227 30.1 Plus
Dvir\GJ23641-PA 574 GJ23641-PA 68..562 31..500 196 23.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21481-PA 505 GK21481-PA 1..505 7..502 1391 74 Plus
Dwil\GK16158-PA 458 GK16158-PA 100..176 134..210 305 87 Plus
Dwil\GK10610-PA 363 GK10610-PA 25..189 30..184 222 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12124-PA 497 GE12124-PA 1..497 7..502 1553 90.9 Plus
Dyak\GE22592-PA 364 GE22592-PA 25..189 30..184 222 30.1 Plus

RE05515.hyp Sequence

Translation from 214 to 1722

> RE05515.hyp
MTKRLRMKREMNDEGEGPQDQKRNRRNEETVRILIPSSIAGAVIGKGGQH
IQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEMLKYFEERDED
FDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVV
QTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFDRVYADEYGGYGT
GSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGAD
RFGGAAGGAVAGAGMGQRDNPFINPWANGGGGDVDGFGNNAGGAGGFAGN
SFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFS
QNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFN
AVGGANGGPNGSPNAATNVPQGHDPNNSTQVTIPKELAGAIIGKGGGRIR
RIRNESSAYITIDEPLPNSNDRIITISGTPKQIQMAQYLLQQSVHENGRR
NI*

RE05515.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
bl-PC 502 CG13425-PC 1..502 1..502 2644 100 Plus
bl-PF 496 CG13425-PF 1..496 7..502 2615 100 Plus
bl-PA 496 CG13425-PA 1..496 7..502 2615 100 Plus
bl-PE 493 CG13425-PE 1..486 7..492 2562 100 Plus
bl-PB 413 CG13425-PB 1..413 90..502 2200 100 Plus