Clone RE05851 Report

Search the DGRC for RE05851

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:58
Well:51
Vector:pFlc-1
Associated Gene/TranscriptCG11381-RA
Protein status:RE05851.pep: gold
Sequenced Size:1578

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11381 2010-06-24 Manual selection by Sue Celniker

Clone Sequence Records

RE05851.complete Sequence

1578 bp assembled on 2010-12-02

GenBank Submission: BT125792.1

> RE05851.complete
ATTGCTCACTCAGCATTCAAGCCCCCAAATCAGCCGCATAGACGATGCTC
AAAGCCGCAAAGATCCCCTTGTTCTTCGCCCTTTTGGGTGCTGTGTGTAT
CCAGGCCGTCGTGGTTGGTCCCCAGCCATTGCATAATAACAACAGGAACG
GCTACCGCTACAATGGCCCCGCCCACAAGTATCTCCCATCGGAGGAGTCG
CACTCGCACGGCAGCCCCTTGGATTCGAGTCACCAGCATGATCAGCAGGG
CCCCAGTAATGCCTACAACTCACATCATTACCCAGCACAGGAGCAACATG
GCCAGGGAGCGCCGGAGCACGACCATCAGCAGAAGGAGGTTGACTCCTGG
CAAACGGCTCTTTCCCAGCAGCAACACGAGAGCTTCGGAAACCAGCAAAA
TCATCAGAACGCCTACAATGAAGGACCTGTGTACCAGCACTATCAGGGAT
TTAACCACCAACAACATTATGGATTAAGCCAACAGCAACAGCATGAAAGC
TACGGGCAGGAACACTATCAACAGAGCCCCAACCAGCTGCAACACCATCA
GTCCCAACACGCAAACGAATATGCCTACGAACCAGCTCATTTCCAGCAGC
AACAGCAGCATCACGAAATTCAGGGTCACAAGCAGCATCAGCAGAGGAAA
GAGCACTGGAACTTCGTTCAAGAGCAGCAACCCCAAAATCACGAACCCTG
GCAATCTTCGCATGGCTTCCAACAGCACCAGCAGCAGCATTCCAATCGCT
TTGAGTCACAGCTTCCGCTGCGGGAAGACCTTTGGCAACCCATTCGTGAG
CTGGACCTAGAGAAGCTTCCTTCGGCTGAGGCGCACGCCAGTAGCCACAA
GACAGTTGCAGCTCCTGGACGAGATGTAAAGCTCGTGCCCAGTTACACGC
TCTCCAGCGACTTTGAGCACGACCGCTTCATCGGACTGGATAGTACGGAC
ACTCGTCTGCTGACCCAATCTCTGCCAGATGCCTACCGGAAACAGCTGTT
CTCCTCGCCACCAGAACCATCGTCTTTAGCCCAGGGACATAACCAGCAAC
ACAAGCCCGGATCCGCAGCCTATGGTGGTTCCCACGGACCATCCCTTGGC
GAATCCACATCCGATTTCCTGCAAATGCAGTCCCACTCGTATCAGCTGCC
TTCAACGTTTACTACTCACACGGAATGGACCCAGGACAAGGAGCAGCATC
AGCACAATCCCCAGCAGCAGGCCACCGGCAATCGTCAGTACTCGGCTAGT
GCCTTCGCAGTGTCCCCTTCGTATCTGCACGCCTCCGAAGCCTCCCAGCC
GCCCAAGAACAGCTTGCCACATCCTAGCCGTGACTTCCAGCCACCTTACT
ACTAAGGCCCTTGAACAGACTTAATAACTGAATTAACTGGTAGTTCGATG
CTCCACATCAACCATAAGATCGTACCAACTTCAACATTCGCTTTTCCCCG
GAAAAGCATTTGGTCTGAAAAGCAAAACTATCACAGCAAGAAGTGTGCAG
ATAAATACTTTTCCCTTTTTTTTTTATATATATATATTTAATAAAGAGTG
CATTGGTGAACCGAAAAAAAAAAAAAAA

RE05851.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1097910..1099411 61..1562 7510 100 Plus
chrX 22417052 chrX 1097796..1097857 1..62 310 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-RA 1311 CG11381-PA 1..1311 45..1355 6555 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-RA 1603 CG11381-RA 42..1603 1..1562 7810 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-PA 436 CG11381-PA 1..436 45..1352 2020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1203932..1205433 61..1562 7510 100 Plus
X 23542271 X 1203818..1203879 1..62 310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1212030..1213531 61..1562 7510 100 Plus
X 23527363 X 1211916..1211977 1..62 310 100 Plus
Blast to na_te.dros performed 2014-11-27 16:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6715..6920 473..681 234 62.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..7002 454..739 212 59.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6964 511..757 212 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2464 594..739 202 63.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6719..6861 591..739 199 63.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2331..2544 480..690 198 61.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6918 532..739 198 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2308..2514 532..738 196 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2616 519..819 193 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2356..2687 454..770 193 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2372..2510 506..644 190 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..7012 366..617 182 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6756..7013 433..696 181 58.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2608 543..849 180 54.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6735..6944 433..639 179 56.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2473 485..655 172 59 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6726..6951 391..613 168 57.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2647..2945 454..746 167 56.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6758..6897 594..739 167 60.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6646..6880 511..740 165 56.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2440 599..739 142 58.2 Plus
roo 9092 roo DM_ROO 9092bp 1006..1150 481..617 139 60.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1373..1600 438..656 136 55 Plus
roo 9092 roo DM_ROO 9092bp 1059..1161 581..691 130 64.3 Plus

RE05851.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:51:55 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1097912..1099411 63..1563 97   Plus
chrX 1097796..1097857 1..62 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-12-03 14:28:52 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 1..1311 45..1355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:34 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 1..1311 45..1355 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:32:22 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 1..1311 45..1355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:51:55 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 1..1311 45..1355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-12-03 14:28:51 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 40..1601 1..1563 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:34 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 40..1601 1..1563 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:32:22 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 42..1603 1..1562 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:51:55 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11381-RA 42..1603 1..1562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:51:55 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
X 1203934..1205433 63..1563 99   Plus
X 1203818..1203879 1..62 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:32:22 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1097967..1099466 63..1563 99   Plus
arm_X 1097851..1097912 1..62 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:51:47 Download gff for RE05851.complete
Subject Subject Range Query Range Percent Splice Strand
X 1212032..1213531 63..1563 99   Plus
X 1211916..1211977 1..62 100 -> Plus

RE05851.pep Sequence

Translation from 44 to 1354

> RE05851.pep
MLKAAKIPLFFALLGAVCIQAVVVGPQPLHNNNRNGYRYNGPAHKYLPSE
ESHSHGSPLDSSHQHDQQGPSNAYNSHHYPAQEQHGQGAPEHDHQQKEVD
SWQTALSQQQHESFGNQQNHQNAYNEGPVYQHYQGFNHQQHYGLSQQQQH
ESYGQEHYQQSPNQLQHHQSQHANEYAYEPAHFQQQQQHHEIQGHKQHQQ
RKEHWNFVQEQQPQNHEPWQSSHGFQQHQQQHSNRFESQLPLREDLWQPI
RELDLEKLPSAEAHASSHKTVAAPGRDVKLVPSYTLSSDFEHDRFIGLDS
TDTRLLTQSLPDAYRKQLFSSPPEPSSLAQGHNQQHKPGSAAYGGSHGPS
LGESTSDFLQMQSHSYQLPSTFTTHTEWTQDKEQHQHNPQQQATGNRQYS
ASAFAVSPSYLHASEASQPPKNSLPHPSRDFQPPYY*

RE05851.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22142-PA 553 GF22142-PA 274..553 181..436 566 48.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12836-PA 477 GG12836-PA 3..477 2..436 1466 70.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-PA 436 CG11381-PA 1..436 1..436 2407 100 Plus
Smr-PF 3601 CG4013-PF 4..291 16..283 213 24.6 Plus
Smr-PE 3601 CG4013-PE 4..291 16..283 213 24.6 Plus
Smr-PD 3601 CG4013-PD 4..291 16..283 213 24.6 Plus
Smr-PG 3607 CG4013-PG 4..297 16..283 202 23.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14236-PA 444 GL14236-PA 241..443 247..436 377 47.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10963-PA 449 GA10963-PA 243..448 247..436 383 47.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19121-PA 436 GM19121-PA 1..436 1..436 1984 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16548-PA 436 GD16548-PA 1..436 1..436 1955 93.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 15:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24900-PA 424 GK24900-PA 279..424 245..436 217 39.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16671-PA 407 GE16671-PA 1..407 1..436 1173 66.9 Plus

RE05851.hyp Sequence

Translation from 44 to 1354

> RE05851.hyp
MLKAAKIPLFFALLGAVCIQAVVVGPQPLHNNNRNGYRYNGPAHKYLPSE
ESHSHGSPLDSSHQHDQQGPSNAYNSHHYPAQEQHGQGAPEHDHQQKEVD
SWQTALSQQQHESFGNQQNHQNAYNEGPVYQHYQGFNHQQHYGLSQQQQH
ESYGQEHYQQSPNQLQHHQSQHANEYAYEPAHFQQQQQHHEIQGHKQHQQ
RKEHWNFVQEQQPQNHEPWQSSHGFQQHQQQHSNRFESQLPLREDLWQPI
RELDLEKLPSAEAHASSHKTVAAPGRDVKLVPSYTLSSDFEHDRFIGLDS
TDTRLLTQSLPDAYRKQLFSSPPEPSSLAQGHNQQHKPGSAAYGGSHGPS
LGESTSDFLQMQSHSYQLPSTFTTHTEWTQDKEQHQHNPQQQATGNRQYS
ASAFAVSPSYLHASEASQPPKNSLPHPSRDFQPPYY*

RE05851.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11381-PA 436 CG11381-PA 1..436 1..436 2407 100 Plus
Smr-PF 3601 CG4013-PF 4..291 16..283 213 24.6 Plus
Smr-PE 3601 CG4013-PE 4..291 16..283 213 24.6 Plus
Smr-PD 3601 CG4013-PD 4..291 16..283 213 24.6 Plus
Smr-PG 3607 CG4013-PG 4..297 16..283 202 23.9 Plus