Clone RE06427 Report

Search the DGRC for RE06427

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:64
Well:27
Vector:pFlc-1
Associated Gene/TranscriptVha100-1-RB
Protein status:RE06427.pep: gold
Sequenced Size:3061

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Vha100-1-RH 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE06427.complete Sequence

3061 bp assembled on 2009-12-14

GenBank Submission: BT120052.1

> RE06427.complete
ATTTATTTTCCCTAGGAATAGTAACTGCGAATAGCATTTGTGTTTTTTAA
ATGTTTTTTATAATATTTCCCAGATATTTGTTTTTAAGTACAAATTTATT
TCCCTAGTTACTCGATTGGTATAAATCCAATGACCTGCCACGGTCACACT
AGATTCATAGTTCGGAAATTTGTCGGTTGCTGGAGTTTGTGGACGAATTT
ATATTTAATTTTTAAGCACTTGATATCGGGAATCCGGCTGCCACAATGGG
TTCCCTATTCCGCAGCGAGGAAATGGCGCTGTGCCAGCTGTTCCTGCAGA
GCGAGGCGGCCTACGCCTGCGTCTCCGAGTTGGGAGAACTGGGATTGGTC
CAGTTCCGAGATCTCAATCCCGATGTCAACGCTTTCCAGAGGAAGTTCGT
CAACGAGGTGCGCCGCTGCGATGAGATGGAGCGCAAGCTGCGTTACCTGG
AGAAGGAGATCAAGAAGGACGGCATCCCCATGTTGGACACCGGGGAGAGT
CCCGAGGCCCCGCAGCCCCGCGAGATGATCGACCTGGAGGCCACCTTTGA
GAAGCTGGAGAACGAGCTGAGGGAGGTGAATCAGAACGCCGAGGCCCTGA
AGCGCAACTTTCTGGAGCTGACCGAGCTGAAGCATATTTTGCGCAAAACC
CAAGTGTTCTTCGATGAGCAAGAAGGCGGCGTAAACCAAACGACCGAGTC
GATGACCCGCGCCTTGATCACGGACGAGGCGCGCACCGCTGGTGCCTCCA
TGGGTCCCGTACAGCTCGGCTTCGTGGCTGGCGTCATCCTGAGGGAGCGA
CTGCCGGCCTTCGAGCGGATGTTGTGGCGCGCCTGCAGGGGTAACGTCTT
CCTGCGACAGGCGATGATTGAGACGCCGCTGGAGGATCCCACCAATGGCG
ACCAGGTGCACAAGTCCGTGTTTATAATCTTCTTCCAGGGTGACCAGCTG
AAGACGCGCGTCAAGAAGATCTGCGAGGGCTTCCGGGCCACGCTCTATCC
TTGCCCTGAAGCTCCAGCCGATCGGCGAGAGATGGCCATGGGTGTGATGA
CTCGCATCGAAGATCTGAACACCGTGCTCGGCCAGACGCAGGACCATCGC
CATCGTGTGCTGGTCGCTGCGGCCAAGAATCTTAAGAACTGGTTCGTCAA
GGTGCGCAAGATAAAGGCCATCTACCATACGCTGAATCTCTTCAATCTGG
ACGTGACCCAGAAGTGTCTGATCGCCGAGTGCTGGGTACCGCTGCTGGAC
ATTGAAACCATCCAGCTGGCCTTGCGCCGCGGAACCGAAAGATCGGGATC
GTCGGTGCCGCCAATTCTCAACCGGATGCAGACGTTCGAGAATCCACCGA
CCTACAATCGAACGAATAAGTTTACCAAGGCCTTTCAGGCATTGATCGAT
GCCTATGGCGTGGCCAGCTATCGGGAGATGAATCCGGCACCCTACACGAT
CATCACCTTCCCCTTCCTGTTCGCCGTGATGTTTGGAGATTTGGGCCACG
GAGCTATCATGGCGCTCTTTGGTCTCTGGATGATTCGAAAGGAGAAGGGA
CTGGCGGCTCAGAAGACGGACAACGAGATCTGGAACATATTCTTTGGCGG
ACGGTACATCATCTTCCTCATGGGCGTCTTCTCCATGTACACGGGTCTTA
TATACAACGATATATTCTCCAAGTCGCTGAATATCTTTGGATCGCATTGG
CACTTATCCTACAACAAGTCCACCGTGATGGAGAACAAGTTCCTGCAGTT
GAGCCCGAAAGGCGACTACGAGGGCGCTCCGTATCCGTTCGGCATGGATC
CCATTTGGCAGGTGGCGGGAGCCAATAAGATCATCTTCCACAACGCTTAC
AAGATGAAGATCTCGATCATTTTCGGTGTTATTCACATGATCTTCGGTGT
GGTGATGAGCTGGCACAATCATACGTATTTCAGGAACAGGATCTCCCTGC
TCTACGAGTTCATTCCCCAGCTGGTCTTCCTGCTGCTGCTTTTCTTCTAC
ATGGTTTTGTTGATGTTCATCAAGTGGATCAAGTTTGCCGCCACCAATGA
TAAGCCCTACTCCGAAGCCTGTGCGCCTTCAATCCTGATCACCTTTATCG
ACATGGTGCTTTTTAACACGCCCAAGCCACCTCCGGAGAACTGTGAAACC
TATATGTTCATGGGCCAGCACTTTATCCAGGTGTTATTCGTCCTGGTTGC
CGTCGGCTGCATTCCCGTAATGTTGCTGGCCAAGCCGCTGCTCATCATGC
AGGCCCGCAAGCAGGCGAACGTACAGCCCATTGCAGGAGCAACTTCAGAT
GCAGAAGCCGGCGGCGTGTCCAATAGCGGCTCACACGGTGGTGGCGGTGG
CCATGAGGAGGAAGAGGAGCTCTCTGAGATCTTCATTCACCAGAGCATCC
ACACCATCGAGTACGTCCTAGGTTCGGTATCCCACACCGCTTCCTATCTG
CGATTGTGGGCGCTTTCCTTGGCCCATGCCCAGTTGGCTGAGGTGCTGTG
GACCATGGTCCTATCGATTGGCTTGAAGCAGGAAGGGCCGGTGGGTGGCA
TTGTATTGACCTGCGTGTTTGCCTTCTGGGCCATTCTCACCGTTGGCATT
CTGGTACTCATGGAGGGCTTGTCTGCCTTCCTGCACACCCTGCGTCTCCA
TTGGGTCGAGTTCCAGAGCAAGTTCTACAAGGGCCAGGGTTACGCCTTCC
AACCCTTCTCGTTTGATGCCATCATAGAAAACGGAGCTGCCGCCGCCGAG
GAGTAAATAAAGCGGAATATCGGTCAGAGCAACAACCAAAGCACGTTGAG
AGTCTCATTGCGTTATATGAAATTAACTATCCAAATAAGTGGAATCTACC
AGTTACAGTAACAAACATATATGTACGTTTTAATGTTTAATTGTCGTGAA
TTTATCTATGTATGTATATCGTATAGCCCCAGCAAACGTTAGATTGCTAA
CAATATTTAATGTTCTTCGTAGACGTTCTCCTGTTTATTAACTATACTTG
TAAACTCAAATAAATAGAAAAGGCTAACCCCTTGGGGTTGGCACCAAAAA
AAAAAAAAAAA

RE06427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-RB 3050 Vha100-1-RB 1..3049 1..3049 15245 100 Plus
Vha100-1-RG 3087 Vha100-1-RG 811..3087 769..3045 11385 100 Plus
Vha100-1-RJ 3096 Vha100-1-RJ 811..2313 769..2271 7515 100 Plus
Vha100-1-RJ 3096 Vha100-1-RJ 2319..3096 2271..3048 3890 100 Plus
Vha100-1-RJ 3096 Vha100-1-RJ 1..769 1..769 3845 100 Plus
Vha100-1-RG 3087 Vha100-1-RG 1..769 1..769 3845 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24958131..24959286 897..2052 5705 99.6 Plus
chr3R 27901430 chr3R 24960448..24960844 2649..3045 1940 99.2 Plus
chr3R 27901430 chr3R 24953948..24954169 1..222 1110 100 Plus
chr3R 27901430 chr3R 24959351..24959571 2053..2273 1075 99.1 Plus
chr3R 27901430 chr3R 24959945..24960155 2271..2481 1025 99.1 Plus
chr3R 27901430 chr3R 24955024..24955201 363..540 875 99.4 Plus
chr3R 27901430 chr3R 24960221..24960393 2482..2654 850 99.4 Plus
chr3R 27901430 chr3R 24954583..24954723 222..362 705 100 Plus
chr3R 27901430 chr3R 24955272..24955402 538..668 655 100 Plus
chr3R 27901430 chr3R 24957917..24958045 769..897 645 100 Plus
chr3R 27901430 chr3R 24956728..24956830 667..769 515 100 Plus
chr2L 23010047 chr2L 11740259..11740472 258..471 320 76.6 Plus
chr3R 27901430 chr3R 14217278..14217376 476..378 315 87.9 Minus
chr3R 27901430 chr3R 14214855..14214962 2708..2601 300 85.2 Minus
chr2L 23010047 chr2L 11741564..11741692 1575..1703 255 79.8 Plus
chr2R 21145070 chr2R 14796204..14796304 2676..2576 250 83.2 Minus
chr3R 27901430 chr3R 14216072..14216197 1700..1575 240 79.4 Minus
chr3R 27901430 chr3R 14212521..14212631 1502..1392 225 80.2 Minus
chr3R 27901430 chr3R 14216535..14216614 1237..1158 220 85 Minus
chr2R 21145070 chr2R 14797438..14797516 1502..1424 215 84.8 Minus
chr2L 23010047 chr2L 11742320..11742405 2376..2461 205 82.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-RK 2511 CG1709-PK 1..2511 246..2756 12555 100 Plus
Vha100-1-RD 2511 CG1709-PD 1..2511 246..2756 12555 100 Plus
Vha100-1-RB 2511 CG1709-PB 1..2511 246..2756 12555 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-RK 2902 CG1709-RK 1..2902 144..3045 14510 100 Plus
Vha100-1-RB 2907 CG1709-RB 1..2902 144..3045 14510 100 Plus
Vha100-1-RD 3009 CG1709-RD 181..3004 222..3045 14120 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-PK 836 CG1709-PK 1..824 246..2717 4068 100 Plus
Vha100-1-PD 836 CG1709-PD 1..824 246..2717 4068 100 Plus
Vha100-1-PB 836 CG1709-PB 1..824 246..2717 4068 100 Plus
Vha100-1-PG 850 CG1709-PG 1..838 246..2717 4043 98.3 Plus
Vha100-1-PJ 852 CG1709-PJ 1..840 246..2717 4030 98.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29135262..29136417 897..2052 5780 100 Plus
3R 32079331 3R 29137579..29137979 2649..3049 1990 99.8 Plus
3R 32079331 3R 29131050..29131271 1..222 1110 100 Plus
3R 32079331 3R 29136482..29136702 2053..2273 1105 100 Plus
3R 32079331 3R 29137076..29137286 2271..2481 1055 100 Plus
3R 32079331 3R 29132126..29132303 363..540 890 100 Plus
3R 32079331 3R 29137352..29137524 2482..2654 865 100 Plus
3R 32079331 3R 29131685..29131825 222..362 705 100 Plus
3R 32079331 3R 29132374..29132504 538..668 655 100 Plus
3R 32079331 3R 29135048..29135176 769..897 645 100 Plus
3R 32079331 3R 29133859..29133961 667..769 515 100 Plus
2L 23513712 2L 11741563..11741776 258..471 320 76.6 Plus
3R 32079331 3R 18393092..18393190 476..378 315 87.9 Minus
3R 32079331 3R 18390664..18390771 2708..2601 285 84.3 Minus
2L 23513712 2L 11742868..11742996 1575..1703 270 80.6 Plus
2R 25286936 2R 18909062..18909162 2676..2576 250 83.2 Minus
3R 32079331 3R 18392349..18392428 1237..1158 235 86.2 Minus
3R 32079331 3R 18388331..18388441 1502..1392 225 80.2 Minus
3R 32079331 3R 18391886..18392011 1700..1575 225 78.6 Minus
2R 25286936 2R 18910296..18910374 1502..1424 215 84.8 Minus
3R 32079331 3R 18391691..18391807 1901..1782 205 80 Minus
2L 23513712 2L 11743624..11743709 2376..2461 205 82.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28876093..28877248 897..2052 5780 100 Plus
3R 31820162 3R 28878410..28878810 2649..3049 1990 99.7 Plus
3R 31820162 3R 28871881..28872102 1..222 1110 100 Plus
3R 31820162 3R 28877313..28877533 2053..2273 1105 100 Plus
3R 31820162 3R 28877907..28878117 2271..2481 1055 100 Plus
3R 31820162 3R 28872957..28873134 363..540 890 100 Plus
3R 31820162 3R 28878183..28878355 2482..2654 865 100 Plus
3R 31820162 3R 28872516..28872656 222..362 705 100 Plus
3R 31820162 3R 28873205..28873335 538..668 655 100 Plus
3R 31820162 3R 28875879..28876007 769..897 645 100 Plus
3R 31820162 3R 28874690..28874792 667..769 515 100 Plus
2L 23513712 2L 11741563..11741776 258..471 320 76.6 Plus
3R 31820162 3R 18133923..18134021 476..378 315 87.8 Minus
3R 31820162 3R 18131495..18131602 2708..2601 285 84.2 Minus
2L 23513712 2L 11742868..11742996 1575..1703 270 80.6 Plus
2R 25260384 2R 18910261..18910361 2676..2576 250 83.1 Minus
3R 31820162 3R 18133180..18133259 1237..1158 235 86.2 Minus
3R 31820162 3R 18132717..18132842 1700..1575 225 78.5 Minus
3R 31820162 3R 18129162..18129272 1502..1392 225 80.1 Minus
2R 25260384 2R 18911495..18911573 1502..1424 215 84.8 Minus
2L 23513712 2L 11743624..11743709 2376..2461 205 82.5 Plus
3R 31820162 3R 18132522..18132596 1901..1827 195 84 Minus
3R 31820162 3R 18132916..18132966 1501..1451 180 90.1 Minus
2L 23513712 2L 11742728..11742801 1429..1502 175 82.4 Plus
2L 23513712 2L 11743116..11743190 1823..1897 165 81.3 Plus
3R 31820162 3R 18129025..18129093 1642..1574 150 81.1 Minus
3R 31820162 3R 18127848..18127915 2677..2610 145 80.8 Minus
Blast to na_te.dros performed 2014-11-27 14:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6819..6865 2017..1971 127 74.5 Minus

RE06427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:20:38 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24960453..24960844 2654..3045 99   Plus
chr3R 24960221..24960392 2482..2653 99 -> Plus
chr3R 24959945..24960155 2271..2481 99 -> Plus
chr3R 24959351..24959568 2053..2270 99 -> Plus
chr3R 24958131..24959286 897..2052 99 -> Plus
chr3R 24957918..24958044 770..896 100 -> Plus
chr3R 24956730..24956830 669..769 100 -> Plus
chr3R 24955274..24955402 540..668 100 -> Plus
chr3R 24955024..24955200 363..539 99 -> Plus
chr3R 24954584..24954723 223..362 100 -> Plus
chr3R 24953948..24954169 1..222 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-14 13:07:44 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RD 1..2511 246..2756 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:29:16 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RG 566..2553 769..2756 100   Plus
Vha100-1-RG 1..523 246..768 100 -> Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:59:38 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 1..2511 246..2756 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:20:38 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 1..2511 246..2756 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-14 13:07:44 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 1..3045 1..3045 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:29:16 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 1..3045 1..3045 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:59:38 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 1..2902 144..3045 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:20:38 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
Vha100-1-RB 1..2902 144..3045 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:20:38 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29137584..29137975 2654..3045 100   Plus
3R 29137352..29137523 2482..2653 100 -> Plus
3R 29137076..29137286 2271..2481 100 -> Plus
3R 29136482..29136699 2053..2270 100 -> Plus
3R 29135262..29136417 897..2052 100 -> Plus
3R 29135049..29135175 770..896 100 -> Plus
3R 29133861..29133961 669..769 100 -> Plus
3R 29132376..29132504 540..668 100 -> Plus
3R 29132126..29132302 363..539 100 -> Plus
3R 29131686..29131825 223..362 100 -> Plus
3R 29131050..29131271 1..222 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:59:38 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24963306..24963697 2654..3045 100   Plus
arm_3R 24963074..24963245 2482..2653 100 -> Plus
arm_3R 24962798..24963008 2271..2481 100 -> Plus
arm_3R 24962204..24962421 2053..2270 100 -> Plus
arm_3R 24960984..24962139 897..2052 100 -> Plus
arm_3R 24960771..24960897 770..896 100 -> Plus
arm_3R 24959583..24959683 669..769 100 -> Plus
arm_3R 24958098..24958226 540..668 100 -> Plus
arm_3R 24957848..24958024 363..539 100 -> Plus
arm_3R 24957408..24957547 223..362 100 -> Plus
arm_3R 24956772..24956993 1..222 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:51 Download gff for RE06427.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28878415..28878806 2654..3045 100   Plus
3R 28878183..28878354 2482..2653 100 -> Plus
3R 28877907..28878117 2271..2481 100 -> Plus
3R 28877313..28877530 2053..2270 100 -> Plus
3R 28876093..28877248 897..2052 100 -> Plus
3R 28875880..28876006 770..896 100 -> Plus
3R 28874692..28874792 669..769 100 -> Plus
3R 28873207..28873335 540..668 100 -> Plus
3R 28872957..28873133 363..539 100 -> Plus
3R 28872517..28872656 223..362 100 -> Plus
3R 28871881..28872102 1..222 100 -> Plus

RE06427.pep Sequence

Translation from 245 to 2755

> RE06427.pep
MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRK
FVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEAT
FEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDEQEGGVNQTT
ESMTRALITDEARTAGASMGPVQLGFVAGVILRERLPAFERMLWRACRGN
VFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRVKKICEGFRATL
YPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWF
VKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERS
GSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPY
TIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFF
GGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFL
QLSPKGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIF
GVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAAT
NDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVL
VAVGCIPVMLLAKPLLIMQARKQANVQPIAGATSDAEAGGVSNSGSHGGG
GGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEV
LWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLR
LHWVEFQSKFYKGQGYAFQPFSFDAIIENGAAAAEE*

RE06427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23290-PA 871 GF23290-PA 1..869 1..835 3979 90.1 Plus
Dana\GF18112-PA 835 GF18112-PA 1..830 1..828 2606 59.5 Plus
Dana\GF14569-PA 810 GF14569-PA 1..805 1..828 2428 57.5 Plus
Dana\GF18113-PA 844 GF18113-PA 14..838 2..827 2304 53.1 Plus
Dana\GF13738-PA 1074 GF13738-PA 516..1035 347..835 1214 46.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11646-PA 890 GG11646-PA 1..890 1..836 4214 92.9 Plus
Dere\GG23732-PA 814 GG23732-PA 1..809 1..828 2411 58.1 Plus
Dere\GG16473-PA 751 GG16473-PA 14..745 94..827 2041 53.2 Plus
Dere\GG20932-PA 895 GG20932-PA 1..888 10..823 1419 36.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17453-PA 682 GH17453-PA 1..680 153..836 3111 83.5 Plus
Dgri\GH19224-PA 837 GH19224-PA 1..831 1..828 2561 58.6 Plus
Dgri\GH11370-PA 816 GH11370-PA 1..811 1..828 2304 56.1 Plus
Dgri\GH19225-PA 848 GH19225-PA 17..842 3..827 2269 52.7 Plus
Dgri\GH19727-PA 869 GH19727-PA 4..862 3..823 1549 39.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-PK 836 CG1709-PK 1..836 1..836 4363 100 Plus
Vha100-1-PD 836 CG1709-PD 1..836 1..836 4363 100 Plus
Vha100-1-PB 836 CG1709-PB 1..836 1..836 4363 100 Plus
Vha100-1-PG 850 CG1709-PG 1..850 1..836 4338 98.4 Plus
Vha100-1-PJ 852 CG1709-PJ 1..852 1..836 4325 98.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22777-PA 892 GI22777-PA 1..890 1..835 3905 84.6 Plus
Dmoj\GI24258-PA 835 GI24258-PA 1..830 1..828 2559 58.5 Plus
Dmoj\GI18075-PA 818 GI18075-PA 1..816 1..831 2344 55.7 Plus
Dmoj\GI24259-PA 847 GI24259-PA 17..841 3..827 2283 52.7 Plus
Dmoj\GI20149-PA 870 GI20149-PA 4..863 5..823 1499 38.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23912-PA 868 GL23912-PA 1..868 1..836 4136 92.2 Plus
Dper\GL23189-PA 834 GL23189-PA 1..829 1..828 2556 59.2 Plus
Dper\GL19314-PA 819 GL19314-PA 1..819 1..833 2381 57.3 Plus
Dper\GL24346-PA 842 GL24346-PA 15..836 3..827 2369 54 Plus
Dper\GL10577-PA 901 GL10577-PA 4..896 3..825 1523 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14320-PC 836 GA14320-PC 1..836 1..836 4177 95.6 Plus
Dpse\GA14320-PE 850 GA14320-PE 1..850 1..836 4155 94 Plus
Dpse\GA14320-PH 852 GA14320-PH 1..852 1..836 4140 93.8 Plus
Dpse\GA14320-PF 833 GA14320-PF 1..833 1..836 4010 92.3 Plus
Dpse\GA14320-PD 855 GA14320-PD 1..855 1..836 3997 90.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12768-PA 890 GM12768-PA 1..890 1..836 4182 93.6 Plus
Dsec\GM18705-PA 834 GM18705-PA 1..829 1..828 2590 59.5 Plus
Dsec\GM19181-PA 814 GM19181-PA 1..809 1..828 2392 57.2 Plus
Dsec\GM18706-PA 1538 GM18706-PA 14..627 2..625 1789 54 Plus
Dsec\GM19860-PA 904 GM19860-PA 13..897 3..823 1498 38.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20170-PA 816 GD20170-PA 1..811 1..828 2596 59.9 Plus
Dsim\GD21418-PA 342 GD21418-PA 1..342 495..836 1804 98.8 Plus
Dsim\GD21417-PA 355 GD21417-PA 1..348 153..486 1784 96 Plus
Dsim\GD23787-PA 634 GD23787-PA 88..629 254..828 1347 52.1 Plus
Dsim\GD20171-PA 580 GD20171-PA 113..574 373..827 1343 56.4 Plus
Dsim\GD20171-PA 580 GD20171-PA 15..113 3..100 319 59.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22780-PA 869 GJ22780-PA 14..867 18..836 3883 85.7 Plus
Dvir\GJ10832-PA 836 GJ10832-PA 1..831 1..828 2566 58.8 Plus
Dvir\GJ16665-PA 818 GJ16665-PA 1..814 1..829 2366 57.3 Plus
Dvir\GJ10833-PA 851 GJ10833-PA 17..845 3..827 2330 53 Plus
Dvir\GJ22427-PA 870 GJ22427-PA 19..863 20..823 1501 39.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11891-PA 894 GK11891-PA 1..892 1..836 3945 86.2 Plus
Dwil\GK11490-PA 833 GK11490-PA 1..828 1..828 2569 58.5 Plus
Dwil\GK11491-PA 850 GK11491-PA 21..844 2..827 2381 53.6 Plus
Dwil\GK24362-PA 759 GK24362-PA 1..755 61..828 2175 56.7 Plus
Dwil\GK20688-PA 873 GK20688-PA 1..866 10..823 1555 38.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23836-PA 888 GE23836-PA 1..888 1..836 4213 93.2 Plus
Dyak\GE25199-PA 834 GE25199-PA 1..829 1..828 2594 59.5 Plus
Dyak\GE18538-PA 814 GE18538-PA 1..809 1..828 2443 58 Plus
Dyak\GE25200-PA 841 GE25200-PA 11..835 2..827 2332 53.6 Plus
Dyak\GE13869-PA 911 GE13869-PA 13..904 3..823 1469 38 Plus

RE06427.hyp Sequence

Translation from 245 to 2755

> RE06427.hyp
MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRK
FVNEVRRCDEMERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEAT
FEKLENELREVNQNAEALKRNFLELTELKHILRKTQVFFDEQEGGVNQTT
ESMTRALITDEARTAGASMGPVQLGFVAGVILRERLPAFERMLWRACRGN
VFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRVKKICEGFRATL
YPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWF
VKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERS
GSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPY
TIITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFF
GGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFL
QLSPKGDYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISIIFGVIHMIF
GVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAAT
NDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVL
VAVGCIPVMLLAKPLLIMQARKQANVQPIAGATSDAEAGGVSNSGSHGGG
GGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEV
LWTMVLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLR
LHWVEFQSKFYKGQGYAFQPFSFDAIIENGAAAAEE*

RE06427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Vha100-1-PK 836 CG1709-PK 1..836 1..836 4363 100 Plus
Vha100-1-PD 836 CG1709-PD 1..836 1..836 4363 100 Plus
Vha100-1-PB 836 CG1709-PB 1..836 1..836 4363 100 Plus
Vha100-1-PG 850 CG1709-PG 1..850 1..836 4338 98.4 Plus
Vha100-1-PJ 852 CG1709-PJ 1..852 1..836 4325 98.1 Plus