Clone RE07124 Report

Search the DGRC for RE07124

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:71
Well:24
Vector:pFlc-1
Associated Gene/Transcriptcbt-RA
Protein status:RE07124.pep: gold
Sequenced Size:1965

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
cbt 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

RE07124.complete Sequence

1965 bp assembled on 2009-09-30

GenBank Submission: BT099918.1

> RE07124.complete
ATTCGTCTCTTGAATTCCGAACGCAACGGTTCGCCTTCGCTCCAAAACGG
CAAGCGGCACTTGAAAGCGCCAGTGCAAAGTTAGCTGAAGTGCAAAAATC
TACACAAACTGAGATTAAACCAAGTGATTAGCCCCGGAACAAAACAAACA
AACAAACACAGACTCTTCAATAAAAAAAAGAGAGTGCAACTGAAATTTGA
AAGTGCAATGGACATGGATACCTTGCTACCTTCACCACCCGCAACGCCCC
CACTAAGGGAAAACAAGTTGGAAATCGTCGCCAAGGACGAACAACAGGTG
AACGAGAATCTGCTAAAGGCAAAGCTCAAGCTGGTGGCCCAAAAGAGTCA
GAAAAATGGAGGGATTATTACACCAAATCCATCGGACACGGAAGACGAGG
CTCCCGAAATAGCGGTTCCCAACAAGAAACCCCGTTTGGAACAACCTGCT
ATGAGCATGACACCGCCGCCGGATCAAAAGCTGGACGATGATCAGAAAGC
GGAAAGGGTTAGCGTCATCATGCGGGTCAACAGTTCTGGCGCTGTCTCTT
CTAGTAGCCAAGACGAGAACTCATCTAGTTCCACCTCCTGCTGTAGTTCC
TCTTCCAACACAAACACAAGTACAAGTTCAGTACCACCCACTGTGGAGGA
CGACTATCCAGAGGCCAATGTGTGGCGCAATCTCAAGTTCAAAATGAACA
GAAAGCGTGCTGCAGAAGTGGCACTACCCCCAGTACAAACACCCGAGACA
CCAGTTGCGAAGCTTGTAACGCCACCTGCTCCAGCGGAATGCATCAAGGA
GGAGGAAATAAAACCTATTCTGACACCGATATATGTTAGCCCAGTAGCTT
CGTCTGCCAGCCAACTTATCCTGCTCAGCACAGTGGCCGCCCAACAGAGC
CCCACACCCGTACCCAAAACGCCAACAATGTCCGAGGAGAAACTAACAAC
CAGAATTACGGCCGCCCAGGCGGCGGCCACCAGAAGTCGCATCTACGAGT
GCAGTTTTCCCGATTGCGGCAAGAATTACTTCAAAAGCAGTCATCTGAAG
GCCCACCAGAGGGTTCACACCGGCGAGCGACCCTTTATCTGCAAGTGGGA
GAACTGTGACAAACGATTCTCCCGTTCCGATGAGTTGTCCCGACACAAAC
GGACCCACACCGGTGAAAAGAAATTCCAGTGCAGCGTCTGCCAGAAGAAA
TTCATGAGAAGCGATCACCTGTCGAAGCACGTCAAACGGCACAACAAGGA
CAAGGCGAACGGAGTGAATCGACATGTCTCCCTGGCCAACAACAACACAT
CAGCTTCGGTAGCGGCTTCCCTCTGCGATGCCTCGCTCCATTTGCGAGCG
ATAGCACCGGCGGGCTCCAGCGCTAGTTCCTCGCCCATCAGTTCCGCCAG
CTTGCAAGTCTACAGCGCCCAAGATCTGCTGAGGCTACAGCAGCAGGCCA
GCAGTTTCACCTTCGGCGGAACCCTGCTTCAAGTGCAGCGATGAGAAGAG
CAATGCGAGCAGCATCAGAACCAATCTCAGCCCCACAGTATCGCCAGCTA
AACAGAGATGAATTCCCACCAAATTTCAAAACAAATTAACATCTGAGTCA
AATTCGAAATGCCTTCTCGCTCTCATGTAGCTGGTGTAGACTTAAGCTTA
GTTAGGAGCTAGATCTTGTCACCGTTTTGTGCATATATCAACTTCAAATT
CAATACGTAATACCCAAATCGGATAGATGCCACTTCTTTCCAGGAGCACA
CAGCACACTTCTTATCTAAGCGATCTTCTTCAGATTAATATTCTGAATAT
CCCTAGTGTTTGTACATACTATAAAGAGACGCATTCGGCGTCCAACATCT
GTGATATTTAAGTTTTCTTAACTCTTTTCTATTGTACCATAGTTGTCAGT
GTAATTCTCTTAAGCTAAAACACACACAATTGTATTTATTGCTAAATGCG
AAAAAAAAAAAAAAA

RE07124.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-RA 2414 cbt-RA 254..2215 1..1962 9780 99.8 Plus
cbt-RB 2610 cbt-RB 843..2528 277..1962 8400 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 476572..477910 1948..610 6590 99.5 Minus
chr2L 23010047 chr2L 477910..478210 577..277 1475 99.3 Minus
chr2L 23010047 chr2L 479411..479688 278..1 1390 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-RA 1287 CG4427-PA 1..1287 208..1494 6435 100 Plus
cbt-RC 1044 CG4427-PC 1..1044 451..1494 5220 100 Plus
cbt-RB 1044 CG4427-PB 1..1044 451..1494 5220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:29:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-RA 2041 CG4427-RA 7..1954 1..1948 9740 100 Plus
cbt-RC 2361 CG4427-RC 603..2274 277..1948 8360 100 Plus
cbt-RB 3243 CG4427-RB 1485..3156 277..1948 8360 100 Plus
cbt-RC 2361 CG4427-RC 7..284 1..278 1390 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-PA 428 CG4427-PA 1..428 208..1491 1494 100 Plus
cbt-PC 347 CG4427-PC 1..347 451..1491 1240 100 Plus
cbt-PB 347 CG4427-PB 1..347 451..1491 1240 100 Plus
Sp1-PB 520 CG1343-PB 189..284 991..1269 352 66.7 Plus
Sp1-PD 715 CG1343-PD 384..479 991..1269 352 66.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 476519..478204 1962..277 8400 99.9 Minus
2L 23513712 2L 479405..479682 278..1 1390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 476519..478204 1962..277 8400 99.8 Minus
2L 23513712 2L 479405..479682 278..1 1390 100 Minus
Blast to na_te.dros performed 2014-11-26 23:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 4827..4893 49..114 125 67.2 Plus

RE07124.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:08:30 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 479413..479688 1..276 100   Minus
chr2L 476570..478210 277..1950 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:16 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 1..1287 208..1494 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:36:12 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 1..1287 208..1494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:04:25 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 1..1287 208..1494 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:30 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 1..1287 208..1494 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-30 10:16:40 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 1..1950 1..1950 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:36:11 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 1..1950 1..1950 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:04:25 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 7..1956 1..1950 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:30 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
cbt-RA 7..1956 1..1950 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:08:30 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
2L 479407..479682 1..276 100   Minus
2L 476531..478204 277..1950 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:04:25 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 479407..479682 1..276 100   Minus
arm_2L 476531..478204 277..1950 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:33 Download gff for RE07124.complete
Subject Subject Range Query Range Percent Splice Strand
2L 479407..479682 1..276 100   Minus
2L 476531..478204 277..1950 99 <- Minus

RE07124.pep Sequence

Translation from 207 to 1493

> RE07124.pep
MDMDTLLPSPPATPPLRENKLEIVAKDEQQVNENLLKAKLKLVAQKSQKN
GGIITPNPSDTEDEAPEIAVPNKKPRLEQPAMSMTPPPDQKLDDDQKAER
VSVIMRVNSSGAVSSSSQDENSSSSTSCCSSSSNTNTSTSSVPPTVEDDY
PEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEE
IKPILTPIYVSPVASSASQLILLSTVAAQQSPTPVPKTPTMSEEKLTTRI
TAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENC
DKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNKDKA
NGVNRHVSLANNNTSASVAASLCDASLHLRAIAPAGSSASSSPISSASLQ
VYSAQDLLRLQQQASSFTFGGTLLQVQR*

RE07124.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\cbt-PA 425 GF24751-PA 1..425 1..428 1586 76.3 Plus
Dana\GF18887-PA 925 GF18887-PA 699..837 259..391 379 51.4 Plus
Dana\GF22533-PA 454 GF22533-PA 73..170 249..346 364 63.3 Plus
Dana\GF24217-PA 771 GF24217-PA 680..766 259..345 338 60.9 Plus
Dana\GF12443-PA 552 GF12443-PA 465..551 259..345 323 60.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\cbt-PA 428 GG24646-PA 1..428 1..428 1888 95.1 Plus
Dere\GG18323-PA 714 GG18323-PA 377..485 249..354 380 60.6 Plus
Dere\GG12363-PA 964 GG12363-PA 732..824 259..351 373 62.4 Plus
Dere\GG15151-PA 774 GG15151-PA 683..769 259..345 340 60.9 Plus
Dere\GG22702-PA 562 GG22702-PA 475..561 259..345 320 60.9 Plus
Dere\GG12363-PA 964 GG12363-PA 761..818 258..317 176 48.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\cbt-PA 446 GH10513-PA 1..436 1..418 1133 58.4 Plus
Dgri\GH18919-PA 1018 GH18919-PA 788..880 259..351 388 64.5 Plus
Dgri\GH11802-PA 689 GH11802-PA 375..481 249..355 387 59.8 Plus
Dgri\GH16421-PA 749 GH16421-PA 658..744 259..345 338 60.9 Plus
Dgri\GH20565-PA 595 GH20565-PA 507..594 258..345 320 59.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-PA 428 CG4427-PA 1..428 1..428 2193 100 Plus
cbt-PC 347 CG4427-PC 1..347 82..428 1780 100 Plus
cbt-PB 347 CG4427-PB 1..347 82..428 1780 100 Plus
Spps-PA 968 CG5669-PA 606..874 170..397 364 30.9 Plus
Sp1-PB 520 CG1343-PB 127..298 215..371 359 44.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\cbt-PA 455 GI18030-PA 1..452 1..424 1174 58.8 Plus
Dmoj\GI23419-PA 1030 GI23419-PA 805..897 259..351 388 64.5 Plus
Dmoj\GI15983-PA 675 GI15983-PA 370..476 249..355 387 59.8 Plus
Dmoj\GI19759-PA 506 GI19759-PA 419..505 259..345 316 59.8 Plus
Dmoj\GI18350-PA 387 GI18350-PA 303..387 261..345 305 57.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\cbt-PA 436 GL19259-PA 1..436 1..428 1163 64.4 Plus
Dper\GL16372-PA 703 GL16372-PA 378..484 249..355 386 59.8 Plus
Dper\GL24133-PA 1000 GL24133-PA 763..855 259..351 382 63.4 Plus
Dper\GL21001-PA 891 GL21001-PA 801..886 259..345 330 60.9 Plus
Dper\GL20646-PA 255 GL20646-PA 168..254 259..345 304 59.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\cbt-PA 450 GA18176-PA 1..450 1..428 1363 70.5 Plus
Dpse\GA12282-PA 703 GA12282-PA 379..485 249..355 386 59.8 Plus
Dpse\GA19045-PC 999 GA19045-PC 762..854 259..351 382 63.4 Plus
Dpse\GA22354-PA 726 GA22354-PA 351..433 265..349 298 62.4 Plus
Dpse\GA22108-PA 203 GA22108-PA 119..203 261..345 296 57.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\cbt-PA 428 GM16664-PA 1..428 1..428 2042 97.9 Plus
Dsec\GM11386-PA 510 GM11386-PA 176..284 249..354 376 60.6 Plus
Dsec\GM23502-PA 966 GM23502-PA 735..827 259..351 372 62.4 Plus
Dsec\GM14583-PA 750 GM14583-PA 659..745 259..345 339 60.9 Plus
Dsec\GM20477-PA 570 GM20477-PA 483..569 259..345 322 60.9 Plus
Dsec\GM23502-PA 966 GM23502-PA 764..821 258..317 167 46.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\cbt-PA 428 GD22954-PA 1..428 1..428 2247 98.8 Plus
Dsim\GD18309-PA 969 GD18309-PA 737..829 259..351 373 62.4 Plus
Dsim\GD25089-PA 363 GD25089-PA 279..363 261..345 307 57.6 Plus
Dsim\GD13775-PA 402 GD13775-PA 322..397 270..345 303 64.5 Plus
Dsim\GD16275-PA 311 GD16275-PA 191..281 257..347 290 54.9 Plus
Dsim\GD18309-PA 969 GD18309-PA 766..823 258..317 167 46.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\cbt-PA 465 GJ19723-PA 1..452 1..416 1132 59.1 Plus
Dvir\GJ18712-PA 902 GJ18712-PA 622..728 249..355 377 59.8 Plus
Dvir\GJ14523-PA 474 GJ14523-PA 240..340 251..351 371 60.4 Plus
Dvir\GJ12406-PA 759 GJ12406-PA 668..754 259..345 338 60.9 Plus
Dvir\GJ19699-PA 383 GJ19699-PA 99..243 247..391 318 44.9 Plus
Dvir\GJ18712-PA 902 GJ18712-PA 300..382 265..349 290 62.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\cbt-PA 444 GK24649-PA 1..420 1..410 1006 54.7 Plus
Dwil\GK25356-PA 698 GK25356-PA 385..491 249..355 385 59.8 Plus
Dwil\GK11712-PA 961 GK11712-PA 717..809 259..351 383 64.5 Plus
Dwil\GK20661-PA 597 GK20661-PA 510..596 259..345 324 60.9 Plus
Dwil\GK20520-PA 109 GK20520-PA 18..104 259..345 309 60.9 Plus
Dwil\GK11712-PA 961 GK11712-PA 746..803 258..317 162 46.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\cbt-PA 428 GE16084-PA 1..428 1..428 1927 96.7 Plus
Dyak\GE17808-PA 712 GE17808-PA 372..480 249..354 380 60.6 Plus
Dyak\GE10816-PA 968 GE10816-PA 736..828 259..351 373 62.4 Plus
Dyak\GE21373-PA 776 GE21373-PA 685..771 259..345 338 60.9 Plus
Dyak\GE13058-PA 576 GE13058-PA 489..575 259..345 320 60.9 Plus
Dyak\GE10816-PA 968 GE10816-PA 765..822 258..317 167 46.7 Plus

RE07124.hyp Sequence

Translation from 207 to 1493

> RE07124.hyp
MDMDTLLPSPPATPPLRENKLEIVAKDEQQVNENLLKAKLKLVAQKSQKN
GGIITPNPSDTEDEAPEIAVPNKKPRLEQPAMSMTPPPDQKLDDDQKAER
VSVIMRVNSSGAVSSSSQDENSSSSTSCCSSSSNTNTSTSSVPPTVEDDY
PEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAKLVTPPAPAECIKEEE
IKPILTPIYVSPVASSASQLILLSTVAAQQSPTPVPKTPTMSEEKLTTRI
TAAQAAATRSRIYECSFPDCGKNYFKSSHLKAHQRVHTGERPFICKWENC
DKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRHNKDKA
NGVNRHVSLANNNTSASVAASLCDASLHLRAIAPAGSSASSSPISSASLQ
VYSAQDLLRLQQQASSFTFGGTLLQVQR*

RE07124.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
cbt-PA 428 CG4427-PA 1..428 1..428 2193 100 Plus
cbt-PC 347 CG4427-PC 1..347 82..428 1780 100 Plus
cbt-PB 347 CG4427-PB 1..347 82..428 1780 100 Plus
Spps-PA 968 CG5669-PA 606..874 170..397 364 30.9 Plus
Sp1-PB 520 CG1343-PB 127..298 215..371 359 44.8 Plus