Clone RE07428 Report

Search the DGRC for RE07428

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:74
Well:28
Vector:pFlc-1
Associated Gene/Transcriptscramb1-RB
Protein status:RE07428.pep: gold
Sequenced Size:1665

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
scramb1-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE07428.complete Sequence

1665 bp assembled on 2009-07-30

GenBank Submission: BT089011.1

> RE07428.complete
AGTTCATCTCTGTGCTGCAGAGCAGGCAGTCGTGTCAGTCTGAAAAAATG
TCCACCGAAAACCCAGCAAGTTGTGTTTCCACGCTGGACCTAAGTGGTGG
CGAAAATCGGGGAAATCCGGAGGAATCTCATTCCAGGGGCGTGAGGAGCG
GCTCCAAGGTGCTGCGCTTAATCTGGCACTCGCTGTATAGCCAGTATAAT
CAGATCTGCTCGAGATCCCAGACTCTAAGGCAACTGGTTTGCAGGGAAGC
CAACAAACCACTGCCCAAGAAACTCAGGCACACAATGAGACTAAATAAGT
CGGCCAAGCGAAAGGGATACGAGTTCTACATGAGCGACGAGGACAGGAGG
AGACTGGATGAGTATACCTACCGGAATTCCGAACTGTCCGCGCGGATTGG
AGTACCTTACGACTATCGACCAGCTTTTAGTTAAGCAAAAGGTCGAGCTG
CTCGAGGCCTTCACTGGTTTCGAGACCAACAACAAGTTCACGATCAAGAA
CGCCCTGGGTCAGAAGGTCTATTTCGCGGCGGAGGACAACGACTGCTGCA
CGCGCAATTGCTGTGGTCCTGCGCGTCCCTTCGACATGCGGGTCTTTGAT
AACTTCCAGCAGGAAGTGATCCACATGCACCGCCCGCTGGCCTGCTCCTC
CTGTCTGTTTCCCTGCTGTCTGCAGAGTATCGAGGTCTCGGCACCACCCG
GCAATGTTATCGGCACCATTGAGCAGGAGTGGTCCATCTGTTCGCCATCC
TTCCGCATCCTCAACCACGTGGGTGACACGGTGATGCGCATCGAAGGACC
TTTCTGCACCTTTTCGCTCTGCGGCGACGTTGAGTTCAATGTTGTTTCGC
TCACTGGTGAGAAGATAGGCAAGATCTCGAAACAGTGGTCGGGCCTGGCA
CGTGAAATTTTCACGGATGCGGACTTCTTCGGCATCAATTTCCCACTGGA
CTTGGATGTGCGCATGAAGGCCGTTTTGCTGGGTGCCACATTCCTCATAG
ATGCCATGTTCTTTGAGAAAGCCGGAAACCAAGAGACCGATAGGCCCGGA
ATGCTTTAGGAATCGGGTGCTGGCTTGTGCGTGAATTGTTTATGCGTTGC
AACCGATTGTTGTGGCGTTTGTGGCAATTGCGAATGCGATTGCGACGATT
AAATGTTGTGCATTATCTTGAGTTGCAACTTTATCCAAATATCTTCCCGG
TGAACTGTCGCGTACTAGTCTTCTGTACCAAATGCTTATTGATGAAAATG
GATCGCACTAATGAAACTCCTTGTTAATTTTGATGAACATACTGAACTCA
GGCTTCCTTCGAGAGGACATTGCCAGAATATAAAACTAACTTTAAGTTAG
CATTTTTTGCTATTTTGCCACAGCAATTACTTGTGTAAAGTATTCAACGA
CAAATCAGCTTTATTTATGAATTTTGTATTGATGCTCTGAAGCGACAACT
AACTAACGAATGATTCGTTATTGAAACATGTACTTTAAACTGTATGTTAA
GTGTCTTATGGAAAGAAAAATATATTTAACATTGTATATTGTTAAGCATC
AGGAAATTTATATATATCCCTACTGATATTATGGAACAGAAGGTTTTCTT
TTTATGTATTACAACAAAAGTTAAATAAATTATAAACTTATATACTGGTA
AAAAAAAAAAAAAAA

RE07428.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-RB 1723 scramb1-RB 14..1662 1..1649 8245 100 Plus
scramb1-RA 2126 scramb1-RA 760..2065 344..1649 6515 99.9 Plus
scramb1-RC 1638 scramb1-RC 351..1638 360..1647 6440 100 Plus
scramb1-RC 1638 scramb1-RC 5..353 1..349 1745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10212238..10212887 1649..1000 3175 99.2 Minus
chr3L 24539361 chr3L 10213359..10213853 842..348 2400 99 Minus
chr3L 24539361 chr3L 10214636..10214985 350..1 1690 98.9 Minus
chr3L 24539361 chr3L 10213143..10213302 1000..841 770 98.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-RC 999 CG32056-PC 1..999 48..1059 4830 98.7 Plus
scramb1-RA 1251 CG32056-PA 536..1251 344..1059 3565 99.9 Plus
scramb1-RB 702 CG32056-PB 1..702 358..1059 3510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-RB 1655 CG32056-RB 7..1655 1..1649 8245 100 Plus
scramb1-RC 1640 CG32056-RC 7..1640 1..1647 8005 99.2 Plus
scramb1-RA 2049 CG32056-RA 746..2049 344..1647 6505 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-PA 416 CG32056-PA 181..416 349..1056 1273 100 Plus
scramb1-PB 233 CG32056-PB 1..233 358..1056 1250 100 Plus
scramb1-PC 332 CG32056-PC 101..332 361..1056 1245 100 Plus
scramb2-PA 263 CG1893-PA 40..263 352..1020 761 59.8 Plus
scramb1-PC 332 CG32056-PC 1..100 48..347 526 100 Plus
CG9084-PB 275 CG9084-PB 67..272 394..1017 236 29.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10220483..10221132 1649..1000 3250 100 Minus
3L 28110227 3L 10221609..10222103 842..348 2475 100 Minus
3L 28110227 3L 10222905..10223254 350..1 1750 100 Minus
3L 28110227 3L 10221393..10221552 1000..841 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10213583..10214232 1649..1000 3250 100 Minus
3L 28103327 3L 10214709..10215203 842..348 2475 100 Minus
3L 28103327 3L 10216005..10216354 350..1 1750 100 Minus
3L 28103327 3L 10214493..10214652 1000..841 800 100 Minus
3L 28103327 3L 3045001..3045113 971..859 175 76.9 Minus
3L 28103327 3L 3046009..3046105 557..461 155 77.3 Minus
Blast to na_te.dros performed 2014-11-27 09:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 5084..5137 1585..1638 144 74.1 Plus

RE07428.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:20:46 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10214637..10214985 1..349 98   Minus
chr3L 10213361..10213851 350..840 98 <- Minus
chr3L 10213144..10213302 841..999 98 <- Minus
chr3L 10212238..10212887 1000..1649 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:18 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RA 532..1251 341..1059 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:12 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RA 532..1251 341..1059 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:05:12 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RC 1..999 48..1059 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:46 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RC 1..999 48..1059 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-30 15:36:08 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RB 5..1651 1..1647 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:12 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RB 5..1651 1..1647 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:05:12 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RB 7..1655 1..1649 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:46 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
scramb1-RB 7..1655 1..1649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:20:46 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10222906..10223254 1..349 100   Minus
3L 10221611..10222101 350..840 100 <- Minus
3L 10221394..10221552 841..999 100 <- Minus
3L 10220483..10221132 1000..1649 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:05:12 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10216006..10216354 1..349 100   Minus
arm_3L 10214711..10215201 350..840 100 <- Minus
arm_3L 10214494..10214652 841..999 100 <- Minus
arm_3L 10213583..10214232 1000..1649 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:05 Download gff for RE07428.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10216006..10216354 1..349 100   Minus
3L 10214711..10215201 350..840 100 <- Minus
3L 10214494..10214652 841..999 100 <- Minus
3L 10213583..10214232 1000..1649 100 <- Minus

RE07428.pep Sequence

Translation from 357 to 1058

> RE07428.pep
MSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNAL
GQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCL
FPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFC
TFSLCGDVEFNVVSLTGEKIGKISKQWSGLAREIFTDADFFGINFPLDLD
VRMKAVLLGATFLIDAMFFEKAGNQETDRPGML*

RE07428.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23835-PA 392 GF23835-PA 160..392 1..233 1210 95.3 Plus
Dana\GF10228-PA 260 GF10228-PA 39..260 1..221 743 59 Plus
Dana\GF12436-PA 376 GF12436-PA 168..374 13..221 243 29.8 Plus
Dana\GF23837-PA 703 GF23837-PA 1..197 14..224 209 27.2 Plus
Dana\GF23836-PA 206 GF23836-PA 4..194 17..218 191 26.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13979-PA 408 GG13979-PA 176..408 1..233 1228 97 Plus
Dere\GG14486-PA 263 GG14486-PA 42..263 1..221 758 59.9 Plus
Dere\GG22697-PA 275 GG22697-PA 67..272 13..220 229 28 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16555-PA 378 GH16555-PA 146..378 1..233 1157 88.8 Plus
Dgri\GH15491-PA 271 GH15491-PA 55..270 1..220 548 47.3 Plus
Dgri\GH22506-PA 224 GH22506-PA 70..223 72..221 449 57.7 Plus
Dgri\GH20589-PA 275 GH20589-PA 67..273 13..221 219 27 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-PB 233 CG32056-PB 1..233 1..233 1250 100 Plus
scramb1-PA 416 CG32056-PA 184..416 1..233 1250 100 Plus
scramb1-PC 332 CG32056-PC 101..332 2..233 1245 100 Plus
scramb2-PA 263 CG1893-PA 42..263 1..221 749 59.9 Plus
CG9084-PB 275 CG9084-PB 67..272 13..220 236 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13845-PA 380 GI13845-PA 148..380 1..233 1134 88 Plus
Dmoj\GI19735-PA 275 GI19735-PA 67..273 13..221 227 27 Plus
Dmoj\GI16767-PA 230 GI16767-PA 11..217 12..222 222 28.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11735-PA 399 GL11735-PA 167..399 1..233 1183 91.8 Plus
Dper\GL11737-PA 247 GL11737-PA 34..247 8..221 890 75.7 Plus
Dper\GL16303-PA 256 GL16303-PA 40..255 1..220 705 59.3 Plus
Dper\GL20642-PA 273 GL20642-PA 65..270 13..220 236 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16644-PA 397 GA16644-PA 165..397 1..233 1180 91.8 Plus
Dpse\GA23464-PA 247 GA23464-PA 34..247 8..221 892 75.7 Plus
Dpse\GA15113-PA 261 GA15113-PA 40..260 1..220 745 61.5 Plus
Dpse\GA21529-PA 273 GA21529-PA 65..270 13..220 236 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24815-PA 416 GM24815-PA 184..416 1..233 1267 100 Plus
Dsec\GM14090-PA 263 GM14090-PA 42..263 1..221 740 59 Plus
Dsec\GM20472-PA 275 GM20472-PA 67..272 13..220 229 28.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12867-PA 416 GD12867-PA 184..416 1..233 1262 99.1 Plus
Dsim\GD13361-PA 263 GD13361-PA 42..263 1..221 744 59.5 Plus
Dsim\GD25941-PA 275 GD25941-PA 67..272 13..220 229 28.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11709-PA 410 GJ11709-PA 178..410 1..233 1160 89.7 Plus
Dvir\GJ18435-PA 275 GJ18435-PA 67..273 13..221 232 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24075-PA 399 GK24075-PA 167..399 1..233 1166 90.6 Plus
Dwil\GK17620-PA 271 GK17620-PA 50..271 1..221 742 59.9 Plus
Dwil\GK23558-PA 240 GK23558-PA 50..222 1..172 545 58.4 Plus
Dwil\GK20657-PA 275 GK20657-PA 67..272 13..220 233 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20277-PA 408 GE20277-PA 176..408 1..233 1250 98.7 Plus
Dyak\GE21674-PA 263 GE21674-PA 42..263 1..221 748 59.9 Plus
Dyak\GE13050-PA 274 GE13050-PA 66..271 13..220 236 28.5 Plus

RE07428.hyp Sequence

Translation from 357 to 1058

> RE07428.hyp
MSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNAL
GQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCL
FPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFC
TFSLCGDVEFNVVSLTGEKIGKISKQWSGLAREIFTDADFFGINFPLDLD
VRMKAVLLGATFLIDAMFFEKAGNQETDRPGML*

RE07428.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
scramb1-PB 233 CG32056-PB 1..233 1..233 1250 100 Plus
scramb1-PA 416 CG32056-PA 184..416 1..233 1250 100 Plus
scramb1-PC 332 CG32056-PC 101..332 2..233 1245 100 Plus
scramb2-PA 263 CG1893-PA 42..263 1..221 749 59.9 Plus
CG9084-PB 275 CG9084-PB 67..272 13..220 236 29.1 Plus