Clone RE08174 Report

Search the DGRC for RE08174

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:81
Well:74
Vector:pFlc-1
Associated Gene/TranscriptCG11617-RA
Protein status:RE08174.pep: gold
Preliminary Size:885
Sequenced Size:1278

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11617 2001-12-14 Blastp of sequenced clone
CG11617 2002-01-01 Sim4 clustering to Release 2
CG11617 2003-01-01 Sim4 clustering to Release 3
CG11617 2008-04-29 Release 5.5 accounting
CG11617 2008-08-15 Release 5.9 accounting
CG11617 2008-12-18 5.12 accounting

Clone Sequence Records

RE08174.complete Sequence

1278 bp (1278 high quality bases) assembled on 2001-12-14

GenBank Submission: AY070989

> RE08174.complete
AGTCAATTGCTATTAGAACTGCAAACTGCTATTAGCCAATACTTCATCGT
GTTTCCGTTCTCGCAGGAACCTCATGGACAAGTCAACGCGGCCTAAACGA
AATCGTCGACACAGCAGACGAGCCTGGCCACCAGAGGAGGAGTTGCATCC
AGCATCCCGAGCTACAAAGAGATTATTTACTCCCGACATTAAGAGGATGC
TAAAGGACTGGTTAATTCGTCGCCGGGAGAATCCCTATCCTAGCAGGGAG
GAGAAAAAACAGCTTGCTGCAGAGACTGGACTTACTTACACTCAGATTTG
CAATTGGTTTGCAAACTGGCGAAGAAAGCTTAAAAACTCGGAGCGAGAGA
AAGCCAAGAAATCCTGGGGCCATCTGATCAAAAATTACAATCACAATGCA
AGGGGTAATGTGGAACAATTTAGCATCTCGTCGGAGGATAGCATTTGGGA
GGAGGAGATGCACTCATGTCCTGCGGAGGATGACGAAGGCGACGATAATG
AAGAGTTTTCCAGCCACAGTACTGGTAGCGATGGCAATGCCAATAATGAA
CCTTCATCCCCATACAAGCCGATATTGTTTGTAGGATCTGCAGGTCTGAC
CGAGCGGATATCAGCACAAACAGGGGGTAAGACCAAGTACAAGCATCAGA
TGATGGAAAAGTATATGCGAGATAGTTCCACGGCAAAAACGACCAGTCAA
CAGGGTACGCAACTCAACAAGTGGCTGGAAAGTGCAGCAAAATTCACACC
GGACAGGAACAATTATCACATCGAGTGGAATATGACCAGGCAGAAAGCTA
GCAGTAATAGCAGTTGTGGACAAGCGATCTTTACCACAGATGTGTCTGGG
GCTGGTCGTGGTGGACGCTGGATGCTTCATCATAAGGACGAACTGGAAGC
AGCAGAGGCCTTAGCCAACCTCGCCTTCAACTGCAGGCAGCGCTGGCACC
ATATCTAAAGACTGAAGACTCCGGAACTGACGCCATCATTCCAGCAGAAG
TTTCAGGCCCCGCTAAAACGTGCAATCTAGTCAAGTGGGCTTCTTCTGGT
TTTCATTTTCGAACTTTACAGTACAATACTCACTCGTTACATGATTTTCT
TCAAGTTTAAAACCTTTTAGCTACACTCATTTAAATTATGTGATAAACTA
CGACGATCATATTCATGTAAACGTGAAAACCAGGTTGCGCCGAGAGTTAA
GAATTACTACAGCTAGTTTAGAGTGAAAAACAATTATATAATTTTTTGAT
TTCTTGTTATACAAAAAAAAAAAAAAAA

RE08174.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-RA 1267 CG11617-RA 1..1267 1..1268 6270 99.7 Plus
CG11617.a 1420 CG11617.a 220..1420 67..1268 5940 99.7 Plus
mRpL10-RA 993 mRpL10-RA 917..993 1268..1191 320 96.1 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 205323..205998 790..115 3380 100 Minus
chr2L 23010047 chr2L 204794..205266 1261..788 2320 99.8 Minus
chr2L 23010047 chr2L 207284..207350 67..1 335 100 Minus
chr2L 23010047 chr2L 206053..206103 117..67 255 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-RB 885 CG11617-PB 1..885 74..958 4425 100 Plus
CG11617-RA 885 CG11617-PA 1..885 74..958 4425 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:30:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-RA 1259 CG11617-RA 1..1259 1..1260 6250 99.9 Plus
CG11617-RB 1290 CG11617-RB 98..1290 67..1260 5920 99.9 Plus
Tbc1d15-17-RB 3129 CG11490-RB 53..119 67..1 335 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-PB 294 CG11617-PB 1..294 74..955 1458 100 Plus
CG11617-PA 294 CG11617-PA 1..294 74..955 1458 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 205271..205946 790..115 3380 100 Minus
2L 23513712 2L 204735..205214 1268..788 2325 99.4 Minus
2L 23513712 2L 207231..207297 67..1 335 100 Minus
2L 23513712 2L 206001..206051 117..67 255 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 205271..205946 790..115 3380 100 Minus
2L 23513712 2L 204735..205214 1268..788 2335 99.3 Minus
2L 23513712 2L 207231..207297 67..1 335 100 Minus
2L 23513712 2L 206001..206051 117..67 255 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:38:42 has no hits.

RE08174.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:54:33 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 207284..207350 1..67 100   Minus
chr2L 206053..206102 68..117 100 <- Minus
chr2L 205324..205995 118..789 100 <- Minus
chr2L 204793..205264 790..1262 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:51:12 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..885 74..958 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:03:27 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..885 74..958 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:25:35 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..885 74..958 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:28:05 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..885 74..958 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:54:33 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..885 74..958 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:30:36 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..1260 1..1262 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:03:27 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..1260 1..1262 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:25:35 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..1259 1..1260 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:28:05 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..1260 1..1262 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:54:33 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..1259 1..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:54:33 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
2L 207231..207297 1..67 100   Minus
2L 206001..206050 68..117 100 <- Minus
2L 205272..205943 118..789 100 <- Minus
2L 204741..205212 790..1262 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:25:35 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 207231..207297 1..67 100   Minus
arm_2L 206001..206050 68..117 100 <- Minus
arm_2L 205272..205943 118..789 100 <- Minus
arm_2L 204741..205212 790..1262 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:03:56 Download gff for RE08174.complete
Subject Subject Range Query Range Percent Splice Strand
2L 207231..207297 1..67 100   Minus
2L 206001..206050 68..117 100 <- Minus
2L 205272..205943 118..789 100 <- Minus
2L 204741..205212 790..1262 99 <- Minus

RE08174.pep Sequence

Translation from 73 to 957

> RE08174.pep
MDKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRR
RENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKKSWGH
LIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHST
GSDGNANNEPSSPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRD
SSTAKTTSQQGTQLNKWLESAAKFTPDRNNYHIEWNMTRQKASSNSSCGQ
AIFTTDVSGAGRGGRWMLHHKDELEAAEALANLAFNCRQRWHHI*

RE08174.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24526-PA 311 GF24526-PA 1..304 1..293 1152 76 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24672-PA 298 GG24672-PA 1..298 1..294 1352 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10229-PA 333 GH10229-PA 1..326 1..294 1053 66.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-PB 294 CG11617-PB 1..294 1..294 1596 100 Plus
CG11617-PA 294 CG11617-PA 1..294 1..294 1596 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15136-PA 324 GI15136-PA 1..316 1..293 1050 68.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25837-PA 1109 GL25837-PA 1..255 1..239 943 72.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11100-PA 322 GA11100-PA 1..317 1..294 1131 71.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16691-PA 297 GM16691-PA 1..297 1..294 1390 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22979-PA 297 GD22979-PA 1..297 1..294 1388 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17252-PA 318 GJ17252-PA 1..312 1..294 1097 70.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23761-PA 324 GK23761-PA 4..317 2..293 996 68.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16360-PA 298 GE16360-PA 1..298 1..294 1326 89.6 Plus

RE08174.hyp Sequence

Translation from 73 to 957

> RE08174.hyp
MDKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRR
RENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKKSWGH
LIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHST
GSDGNANNEPSSPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRD
SSTAKTTSQQGTQLNKWLESAAKFTPDRNNYHIEWNMTRQKASSNSSCGQ
AIFTTDVSGAGRGGRWMLHHKDELEAAEALANLAFNCRQRWHHI*

RE08174.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-PB 294 CG11617-PB 1..294 1..294 1596 100 Plus
CG11617-PA 294 CG11617-PA 1..294 1..294 1596 100 Plus