Clone RE09463 Report

Search the DGRC for RE09463

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:94
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG3038-RB
Protein status:RE09463.pep: gold
Sequenced Size:1632

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3038-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE09463.complete Sequence

1632 bp assembled on 2010-12-09

GenBank Submission: BT125836.1

> RE09463.complete
AGCACTGGCAAAGGCGTGAAAACAATTGTTATTAACGCATCTCAATTTAT
TTTTTTCTTAATATATAATCGTTTTAGGCATTGTGTTTATTAAAGTTTAG
CAAGATAGACCAAGCCACATATACTTACAGACGGCATAGTGCGAGGGGAA
TCCCACGTAGAATGGATTCAAGCCAGTCCCGCAAAAACGGTTTCTTGCTG
CACTTACCACTCGAAACGAAGAGGAATCCATCTAACCCTAATACTCCGTT
AAGTAATCTTCTGAATCTCACGGACTTCCACTACTTGCTGGCCAGTAATG
TGTGTCGAAAGGCAAAAAGAGAACTCTTAGCCGTTTTAATAGTTACTTCG
TATGCCGGACACGATGCCTTGCGATCAGCTCACCGACAGGCAATTCCCCA
AAGCAAACTGGAAGAAATGGGCCTGCGAAGAGTTTTTCTCTTGGCAGCCC
TGCCTTCAAGAGAGCATTTTATAAGCCAGGATCAACTGGCCAGCGAACAG
AATCGTTTCGGGGACCTTCTCCAGGGGAATTTCATCGAGGACTATCGCAA
TCTGAGCTACAAACACGTAATGGGATTAAAGTGGGTCTCTGAGGAGTGCA
AAAAGCAGGCCAAGTTTATCATTAAACTGGATGATGACATCATTTACGAT
GTGTTTCATCTGCGCAGGTATTTAGAGACCCTCGAGGTGCGCGAACCTGG
ACTGGCCACATCAAGTACTTTGTTATCTGGCTACGTACTGGATGCCAAGC
CCCCCATTCGCCTTCGAGCCAATAAGTGGTACGTTAGCAAAAAGGAGTAT
CCTCAGGCTTTATATCCCGCCTATTTGTCGGGCTGGCTTTACGTGACCAA
CGTGCCAACAGCCGAGAGGATTGTGGCGGAGGCGGAGAGGATGTCATTTT
TTTGGATCGATGACACCTGGTTGACTGGAGTAGTAAGGACTCGTTTGGGT
ATTCCCCTTGAGCGTCACAACGACTGGTTTTCTGCCAATGCAGAGTTCAT
CGACTGCTGTGTGCGAGATCTCAAGAAGCACAACTATGAGTGCGAGTACT
CCGTGGGACCCAATGGCGGTGACGACCGACTACTGGTGGAATTTCTGCAT
AACGTTGAGAAGTGCTACTTTGATGAATGCGTCAAACGGCCGGTTGGTAA
GTCGCTCAAAGAGACCTGTTTAGCGGCGGCCAAATCTCGACCCCCTAAAC
ATGGTTTTCCTGAAATAAAAGCGTTGCGACTCAGGTGACATCGGTTCAAG
GACAAATGGCTTTTCATCCTTTAGCAACTATCATGTAAGGACTTTTTAAA
AGGGGGTGATGAAGGAAGAGACAAATATTGGAAAAGGGATATGATACTCA
TCCTTGCATATATATATATATGCATTACAATAAATGTTTGCCAGAAATCG
ACTTTACATGAATTACTATACACCAGTTTTTTAATTATATATAATTTCGG
TTGCCATAGTAACAGTCGGAAAATTAAATGAAAAATAATAGGACATGAAA
ACATACTTTCATTGTTTTTTTTTTAATCATCAATTTTAAAAATAAAACTG
TTCTAATGTGTTTTTTGTTTTACACTGCATTTTTACGAAATAAATAATAA
TAATAAGATTAAAAACAAAAAAAAAAAAAAAA

RE09463.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 138089..139378 1616..327 6435 99.9 Minus
chrX 22417052 chrX 139440..139606 330..164 835 100 Minus
chrX 22417052 chrX 139707..139870 164..1 820 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-RB 1077 CG3038-PB 1..1077 162..1238 5385 100 Plus
CG3038-RA 1167 CG3038-PA 93..1167 164..1238 5375 100 Plus
CG3038-RC 1080 CG3038-PC 510..1080 668..1238 2855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-RB 1630 CG3038-RB 15..1630 1..1616 8080 100 Plus
CG3038-RA 1731 CG3038-RA 279..1731 164..1616 7265 100 Plus
CG3038-RC 1751 CG3038-RC 696..1644 668..1616 4745 100 Plus
CG3038-RA 1731 CG3038-RA 15..178 1..164 820 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-PB 358 CG3038-PB 1..358 162..1235 1792 100 Plus
CG3038-PA 388 CG3038-PA 32..388 165..1235 1787 100 Plus
CG3038-PC 359 CG3038-PC 32..359 165..1235 1591 91.9 Plus
CG11357-PD 434 CG11357-PD 120..341 273..950 301 31 Plus
CG11357-PC 434 CG11357-PC 120..341 273..950 301 31 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 244046..245350 1631..327 6465 99.7 Minus
X 23542271 X 245412..245578 330..164 835 100 Minus
X 23542271 X 245679..245842 164..1 820 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 252144..253448 1631..327 6465 99.6 Minus
X 23527363 X 253510..253676 330..164 835 100 Minus
X 23527363 X 253777..253940 164..1 820 100 Minus
Blast to na_te.dros performed 2014-11-27 16:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 7113..7219 1335..1439 125 60.2 Plus
jockey2 3428 jockey2 JOCKEY2 3428bp 1316..1361 1567..1612 113 71.7 Plus

RE09463.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:54:13 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 139708..139870 1..163 100   Minus
chrX 139440..139606 164..330 100 <- Minus
chrX 138089..139374 331..1616 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:26 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 1..1077 162..1238 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:34:54 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 1..1077 162..1238 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:54:13 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 1..1077 162..1238 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:26 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 1..1616 1..1616 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:34:54 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 15..1630 1..1616 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:54:13 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
CG3038-RB 15..1630 1..1616 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:54:13 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
X 245680..245842 1..163 100   Minus
X 245412..245578 164..330 100 <- Minus
X 244061..245346 331..1616 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:34:54 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 139713..139875 1..163 100   Minus
arm_X 139445..139611 164..330 100 <- Minus
arm_X 138094..139379 331..1616 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:40 Download gff for RE09463.complete
Subject Subject Range Query Range Percent Splice Strand
X 253778..253940 1..163 100   Minus
X 253510..253676 164..330 100 <- Minus
X 252159..253444 331..1616 100 <- Minus

RE09463.pep Sequence

Translation from 161 to 1237

> RE09463.pep
MDSSQSRKNGFLLHLPLETKRNPSNPNTPLSNLLNLTDFHYLLASNVCRK
AKRELLAVLIVTSYAGHDALRSAHRQAIPQSKLEEMGLRRVFLLAALPSR
EHFISQDQLASEQNRFGDLLQGNFIEDYRNLSYKHVMGLKWVSEECKKQA
KFIIKLDDDIIYDVFHLRRYLETLEVREPGLATSSTLLSGYVLDAKPPIR
LRANKWYVSKKEYPQALYPAYLSGWLYVTNVPTAERIVAEAERMSFFWID
DTWLTGVVRTRLGIPLERHNDWFSANAEFIDCCVRDLKKHNYECEYSVGP
NGGDDRLLVEFLHNVEKCYFDECVKRPVGKSLKETCLAAAKSRPPKHGFP
EIKALRLR*

RE09463.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22180-PA 391 GF22180-PA 38..391 11..358 1579 80.8 Plus
Dana\GF25081-PA 444 GF25081-PA 108..376 16..295 314 29.5 Plus
Dana\GF20020-PA 332 GF20020-PA 49..280 33..266 313 32.8 Plus
Dana\GF20798-PA 325 GF20798-PA 39..278 28..266 309 32.5 Plus
Dana\GF20775-PA 321 GF20775-PA 76..280 56..272 239 29.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12769-PA 389 GG12769-PA 32..389 2..358 1757 92.2 Plus
Dere\GG15238-PA 430 GG15238-PA 100..337 21..263 317 30.9 Plus
Dere\GG10515-PA 585 GG10515-PA 329..558 44..286 245 25.4 Plus
Dere\GG18691-PA 327 GG18691-PA 59..286 36..272 228 27.8 Plus
Dere\GG10514-PA 399 GG10514-PA 140..369 46..285 212 26.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24694-PA 390 GH24694-PA 41..390 8..358 1478 75.5 Plus
Dgri\GH15689-PA 453 GH15689-PA 121..369 23..258 293 31.5 Plus
Dgri\GH11617-PA 614 GH11617-PA 372..587 58..286 246 25.7 Plus
Dgri\GH24143-PA 326 GH24143-PA 56..281 38..268 239 27.6 Plus
Dgri\GH20401-PA 462 GH20401-PA 198..406 86..274 230 27.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-PB 358 CG3038-PB 1..358 1..358 1893 100 Plus
CG3038-PA 388 CG3038-PA 32..388 2..358 1888 100 Plus
CG3038-PC 359 CG3038-PC 32..359 2..358 1692 91.9 Plus
CG11357-PD 434 CG11357-PD 99..341 16..263 319 30.3 Plus
CG11357-PC 434 CG11357-PC 99..341 16..263 319 30.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21823-PA 395 GI21823-PA 32..395 4..358 1420 70.9 Plus
Dmoj\GI12738-PA 449 GI12738-PA 96..376 19..261 291 30.2 Plus
Dmoj\GI23623-PA 347 GI23623-PA 59..292 32..266 286 31.7 Plus
Dmoj\GI17920-PA 607 GI17920-PA 362..580 58..286 251 27.8 Plus
Dmoj\GI19588-PA 452 GI19588-PA 190..396 88..274 229 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13354-PA 389 GL13354-PA 43..389 11..358 1444 75.4 Plus
Dper\GL17908-PA 437 GL17908-PA 94..348 4..258 339 35.2 Plus
Dper\GL14116-PA 335 GL14116-PA 26..284 4..266 271 31.2 Plus
Dper\GL24762-PA 596 GL24762-PA 340..569 44..286 230 24.6 Plus
Dper\GL21389-PA 318 GL21389-PA 87..277 75..273 220 29.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15802-PA 389 GA15802-PA 43..389 11..358 1443 75.4 Plus
Dpse\GA10945-PA 433 GA10945-PA 90..344 4..258 350 35.2 Plus
Dpse\GA27742-PA 335 GA27742-PA 46..284 32..266 275 30.9 Plus
Dpse\GA21248-PA 598 GA21248-PA 342..571 44..286 230 24.6 Plus
Dpse\GA18536-PA 318 GA18536-PA 87..277 75..273 220 29.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19049-PA 364 GM19049-PA 32..359 2..328 1670 95.7 Plus
Dsec\GM14670-PA 433 GM14670-PA 97..340 16..263 316 30.3 Plus
Dsec\GM16754-PA 587 GM16754-PA 331..560 44..286 245 25.4 Plus
Dsec\GM12324-PA 325 GM12324-PA 40..284 13..272 225 26.1 Plus
Dsec\GM16743-PA 414 GM16743-PA 158..384 47..286 210 24.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16488-PA 361 GD16488-PA 32..361 2..330 1684 95.8 Plus
Dsim\GD13851-PA 433 GD13851-PA 97..340 16..263 318 30.3 Plus
Dsim\GD23505-PA 587 GD23505-PA 331..560 44..286 244 25.4 Plus
Dsim\GD16669-PA 325 GD16669-PA 40..284 13..272 222 26 Plus
Dsim\GD25871-PA 466 GD25871-PA 225..406 107..269 208 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16997-PA 404 GJ16997-PA 41..404 8..358 1421 71.3 Plus
Dvir\GJ20815-PA 339 GJ20815-PA 57..288 32..266 276 33.6 Plus
Dvir\GJ15510-PA 472 GJ15510-PA 169..398 31..258 270 31.5 Plus
Dvir\GJ17692-PA 621 GJ17692-PA 376..594 58..286 268 29.1 Plus
Dvir\GJ18347-PA 476 GJ18347-PA 214..416 88..269 229 27.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10121-PA 394 GK10121-PA 46..394 11..358 1459 75.6 Plus
Dwil\GK16591-PA 453 GK16591-PA 122..385 16..258 320 32.3 Plus
Dwil\GK24845-PA 594 GK24845-PA 341..567 47..286 233 24.5 Plus
Dwil\GK15559-PA 329 GK15559-PA 81..288 58..273 227 27.6 Plus
Dwil\GK22248-PA 463 GK22248-PA 205..403 90..269 223 25.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16596-PA 389 GE16596-PA 32..389 2..358 1764 93 Plus
Dyak\GE21457-PA 435 GE21457-PA 105..342 21..263 311 31.3 Plus
Dyak\GE18735-PA 586 GE18735-PA 330..559 44..286 243 25.4 Plus
Dyak\GE16330-PA 327 GE16330-PA 83..286 58..272 229 28.1 Plus
Dyak\GE18734-PA 416 GE18734-PA 172..386 58..285 215 25.8 Plus

RE09463.hyp Sequence

Translation from 161 to 1237

> RE09463.hyp
MDSSQSRKNGFLLHLPLETKRNPSNPNTPLSNLLNLTDFHYLLASNVCRK
AKRELLAVLIVTSYAGHDALRSAHRQAIPQSKLEEMGLRRVFLLAALPSR
EHFISQDQLASEQNRFGDLLQGNFIEDYRNLSYKHVMGLKWVSEECKKQA
KFIIKLDDDIIYDVFHLRRYLETLEVREPGLATSSTLLSGYVLDAKPPIR
LRANKWYVSKKEYPQALYPAYLSGWLYVTNVPTAERIVAEAERMSFFWID
DTWLTGVVRTRLGIPLERHNDWFSANAEFIDCCVRDLKKHNYECEYSVGP
NGGDDRLLVEFLHNVEKCYFDECVKRPVGKSLKETCLAAAKSRPPKHGFP
EIKALRLR*

RE09463.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3038-PB 358 CG3038-PB 1..358 1..358 1893 100 Plus
CG3038-PA 388 CG3038-PA 32..388 2..358 1888 100 Plus
CG3038-PC 359 CG3038-PC 32..359 2..358 1692 91.9 Plus
CG11357-PD 434 CG11357-PD 99..341 16..263 319 30.3 Plus
CG11357-PC 434 CG11357-PC 99..341 16..263 319 30.3 Plus