Clone RE09522 Report

Search the DGRC for RE09522

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:95
Well:22
Vector:pFlc-1
Associated Gene/TranscriptDsp1-RF
Protein status:RE09522.pep: gold
Sequenced Size:2217

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Dsp1-RF 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE09522.complete Sequence

2217 bp assembled on 2009-09-30

GenBank Submission: BT099920.1

> RE09522.complete
GAGTGTATTGTTGTAGCCCAATCGACTGGCATCGCACTAATAATGCTAAT
GAACATCCATCAACCAACTATTGATCAGCAAACAATTCAACACTATCAGC
AGCAATTGGCTGCTCAGCAACAACAACAAGTACAACAGCAACAGTTGCAA
CAACACCAGGTGGTCGTCCAGCAGAATCAGCAGCAGGCGCACCAGAACAG
CTCCAATACCACAGCCGGCGTGGGCACCCAACAGCTGTTCACATACAAAA
TGGCCAGCAGTTTTCCGAATCCGGCCACGACGATGGCCCAAGTGGTGGCC
ACATCGAACGCAGCCGGCACCACGGGCTATGATTATCGTCTAAATATGGC
ACAGGCAGCCGCAGCAGCAGCCGTACCCGGCTCCCAGTGGTGGTATTCGG
CCGCCAATCAGGGACAGGTCGATGCCAATACAGCGGCGCAACTGCAGCAC
CAGCAGCAGCAACAGCAACAGCAACAACAGCAGCAGCAGCAACAGCACCA
GCAGCAACAACAGATGCAACAGCAGCAGCAGCAACAGAATGTCATCAATT
CGGCGAGCCCCATGAGCAGAGTCAAGGCCGATGCCAAGCCCAGAGGCCGA
ATGACCGCCTACGCATACTTTGTACAAACTTGCAGAGAGGAGCACAAAAA
GAAACATCCCGATGAGACGGTGATATTCGCCGAATTCTCGCGGAAGTGCG
CCGAACGGTGGAAGACAATGGTGGACAAGGAGAAGAAGCGCTTCCACGAA
ATGGCCGAGAAGGACAAGCAGCGATATGAGGCGGAAATGCAGAACTATGT
GCCGCCCAAGGGAGCGGTTGTGGGACGCGGCAAGAAGAGGAAACAGATCA
AGGACCCCAATGCTCCAAAACGTTCATTGTCTGCGTTCTTCTGGTTCTGC
AATGACGAGAGAAATAAGGTGAAGGCACTTAATCCCGAGTTCGGAGTGGG
CGACATCGCCAAAGAGCTGGGACGAAAGTGGTCCGATGTGGATCCCGAGG
TCAAGCAGAAGTACGAGTCGATGGCCGAGCGGGACAAGGCTCGATATGAA
CGCGAGATGACCGAGTACAAGACGAGCGGGAAAATAGCCATGTCCGCACC
GTCGATGCAGGCGTCGATGCAGGCGCAGGCACAGAAAGCCGCGTTACTTG
CCGCCGCTGCCCAGCAGCAGCACCAGCAGCTGGAAGAGCAGCACGACGAC
GACGACGGCGATGGAGATGATGACGAGAACCAATAGGTTTAGCAGTAAAT
ACTCTTCACTATTTATACACACGATCGTTGTCGCGATGGAGGAAAGAAAC
ATGATAACGTTGGTTGATCTATTATCAGGTTGGCCAATGTGTGTTGAATA
TAAATTTATATATATAAGGGTGTGCCCGCTTTAGAGGTTTCGCTTTCCGG
TAACAGAACACCGTCACAATTTGTTCAGAAATTTGTCTGGAAAAGTTAAT
ATCAATCGTATTTTGATCAAAGAATAAGTTAAAAATCATGGTGGAATGGT
TAATCTTTTTTTTTTTTTTTTTTTTGTATTCTTTTTAAGCAGTGCGCATA
GAGCTCTTTTGAATCTCTTTTTTCCTTTTTTTTTTTGCATTCATATTTAG
CATCTCCGTATGAGCGGTGTAACTCTTTTGTATTAGAAATATTTGTGTAC
CAATCAATGTCCAACTAAAAATCCAACTATCACAGAAATCTCTTGAACTT
TCAGTAGAGGTTTTCATAGTTAATCGAAGAGAAGAGAAACCATTGTTCCT
AGTGCATTTCGAAAAAAAAAAAACGAAATCTTGTGGAGATTCTGTGAAAT
TTGAGGATTTTTTCGTGCGATTTTCATGCCAGCCGTGGGCAAAATGTCTG
CAGAAGATTTCTGTGATTGGAAAAACCAAAGCATAAATTGTTTTGATTTA
TTTTTTTTTCTGTGACAATTTGATGATTACCTGGAAGTGGAATCTCTAAG
AAAATCACCTATTATGTATATGTAAATGCATATATATAAATAATATATAA
TTTTTTTTTTTAACATAAGTAATCAAATTTCCATGAATTATGAAGATAAA
TCACAAAGAAACCTTTTATAAGTTCTATGTTAAGATGAATACGATTAAGT
ATGGTTAGATTAAAATGACACTCAACTGTCTGCGAACCTTATTTGTGCTT
CAGTGCTAAGTTTCTCCCTAAAGTAATAAGAAAGAACTATTTTATAAATT
GAAAAAAAAAAAAAAAA

RE09522.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-RF 2617 Dsp1-RF 272..2476 2..2207 10975 99.9 Plus
Dsp1.k 3315 Dsp1.k 272..2476 2..2207 10975 99.9 Plus
Dsp1.s 3133 Dsp1.s 272..2476 2..2207 10975 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16227348..16228491 1054..2201 5580 99.5 Plus
chrX 22417052 chrX 16225911..16226464 2..555 2740 99.6 Plus
chrX 22417052 chrX 16227102..16227277 879..1054 880 100 Plus
chrX 22417052 chrX 16226805..16226972 713..880 840 100 Plus
chrX 22417052 chrX 16226571..16226730 555..714 785 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-RF 1194 CG12223-PF 1..1194 43..1236 5970 100 Plus
Dsp1-RE 1182 CG12223-PE 22..1182 76..1236 5805 100 Plus
Dsp1-RG 1161 CG12223-PG 22..1161 97..1236 5700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:31:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-RF 2205 CG12223-RF 7..2205 2..2201 10950 100 Plus
Dsp1-RE 4240 CG12223-RE 263..2387 76..2201 10580 100 Plus
Dsp1-RG 2359 CG12223-RG 143..2246 97..2201 10475 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-PF 397 CG12223-PF 1..348 43..1086 1241 100 Plus
Dsp1-PC 385 CG12223-PC 40..336 196..1086 1222 100 Plus
Dsp1-PA 385 CG12223-PA 40..336 196..1086 1222 100 Plus
Dsp1-PB 385 CG12223-PB 40..336 196..1086 1222 100 Plus
Dsp1-PG 386 CG12223-PG 41..337 196..1086 1222 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16337625..16338777 1054..2207 5705 99.8 Plus
X 23542271 X 16336190..16336743 2..555 2770 100 Plus
X 23542271 X 16337381..16337556 879..1054 880 100 Plus
X 23542271 X 16337084..16337251 713..880 840 100 Plus
X 23542271 X 16336850..16337009 555..714 800 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16345723..16346875 1054..2207 5715 99.8 Plus
X 23527363 X 16344288..16344841 2..555 2770 100 Plus
X 23527363 X 16345479..16345654 879..1054 880 100 Plus
X 23527363 X 16345182..16345349 713..880 840 100 Plus
X 23527363 X 16344948..16345107 555..714 800 100 Plus
X 23527363 X 19552827..19552885 489..431 205 89.8 Minus
Blast to na_te.dros performed 2014-11-27 09:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2398..2854 74..539 344 57 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2296..2837 19..537 300 58.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6886 1120..1248 128 60.2 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 1692..1779 1520..1440 127 64.8 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9574..9661 1520..1440 127 64.8 Minus

RE09522.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:30:31 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16227102..16227276 879..1053 100 -> Plus
chrX 16226807..16226970 715..878 100 -> Plus
chrX 16226571..16226730 555..714 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:14 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 1..1194 43..1236 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:36:17 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 1..1194 43..1236 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:45 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 1..1194 43..1236 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:31 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 1..1194 43..1236 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-30 10:16:36 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 1..2201 1..2201 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:36:17 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 1..2201 1..2201 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:45 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 5..2205 1..2201 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:31 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 5..2205 1..2201 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:30:31 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
X 16337625..16338771 1054..2201 99   Plus
X 16337381..16337555 879..1053 100 -> Plus
X 16337086..16337249 715..878 100 -> Plus
X 16336851..16337009 556..714 100 -> Plus
X 16336188..16336743 1..555 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:45 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16231658..16232804 1054..2201 99   Plus
arm_X 16231414..16231588 879..1053 100 -> Plus
arm_X 16231119..16231282 715..878 100 -> Plus
arm_X 16230884..16231042 556..714 100 -> Plus
arm_X 16230221..16230776 1..555 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:37 Download gff for RE09522.complete
Subject Subject Range Query Range Percent Splice Strand
X 16345723..16346869 1054..2201 99   Plus
X 16345479..16345653 879..1053 100 -> Plus
X 16345184..16345347 715..878 100 -> Plus
X 16344949..16345107 556..714 100 -> Plus
X 16344286..16344841 1..555 99 -> Plus

RE09522.pep Sequence

Translation from 0 to 1235

> RE09522.pep
ECIVVAQSTGIALIMLMNIHQPTIDQQTIQHYQQQLAAQQQQQVQQQQLQ
QHQVVVQQNQQQAHQNSSNTTAGVGTQQLFTYKMASSFPNPATTMAQVVA
TSNAAGTTGYDYRLNMAQAAAAAAVPGSQWWYSAANQGQVDANTAAQLQH
QQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSASPMSRVKADAKPRGR
MTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHE
MAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFC
NDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYE
REMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQHDD
DDGDGDDDENQ*

RE09522.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19115-PA 387 GF19115-PA 42..387 67..411 1411 98 Plus
Dana\GF20527-PA 93 GF20527-PA 1..58 307..364 262 91.4 Plus
Dana\GF20526-PA 98 GF20526-PA 1..98 116..230 254 76.7 Plus
Dana\GF12460-PA 728 GF12460-PA 542..624 276..360 152 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17955-PA 393 GG17955-PA 8..393 26..411 2014 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12282-PA 402 GH12282-PA 52..357 67..369 1347 94.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-PF 397 CG12223-PF 1..397 15..411 2067 100 Plus
Dsp1-PE 393 CG12223-PE 8..393 26..411 2008 100 Plus
Dsp1-PG 386 CG12223-PG 8..386 33..411 1969 100 Plus
Dsp1-PD 386 CG12223-PD 8..386 33..411 1969 100 Plus
Dsp1-PC 385 CG12223-PC 5..385 31..411 1968 99.5 Plus
Dsp1-PE 393 CG12223-PE 118..338 20..266 171 23.4 Plus
Dsp1-PG 386 CG12223-PG 111..331 20..266 171 23.4 Plus
Dsp1-PD 386 CG12223-PD 111..331 20..266 171 23.4 Plus
Dsp1-PG 386 CG12223-PG 6..241 139..356 166 23.2 Plus
Dsp1-PD 386 CG12223-PD 6..241 139..356 166 23.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10980-PA 402 GI10980-PA 52..355 67..369 1352 96.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15829-PA 173 GL15829-PA 1..130 240..369 707 98.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11488-PA 393 GA11488-PA 49..350 67..369 1383 96.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13428-PA 807 GM13428-PA 8..145 26..163 680 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17278-PA 393 GD17278-PA 8..393 26..411 2014 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19445-PA 403 GJ19445-PA 52..358 67..369 1364 95.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25058-PA 406 GK25058-PA 51..359 66..369 1329 94.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17263-PA 394 GE17263-PA 49..394 67..411 1416 99.1 Plus

RE09522.hyp Sequence

Translation from 42 to 1235

> RE09522.hyp
MLMNIHQPTIDQQTIQHYQQQLAAQQQQQVQQQQLQQHQVVVQQNQQQAH
QNSSNTTAGVGTQQLFTYKMASSFPNPATTMAQVVATSNAAGTTGYDYRL
NMAQAAAAAAVPGSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQQ
QHQQQQQMQQQQQQQNVINSASPMSRVKADAKPRGRMTAYAYFVQTCREE
HKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQ
NYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEF
GVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAM
SAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQHDDDDGDGDDDENQ*

RE09522.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-PF 397 CG12223-PF 1..397 1..397 2067 100 Plus
Dsp1-PE 393 CG12223-PE 8..393 12..397 2008 100 Plus
Dsp1-PG 386 CG12223-PG 8..386 19..397 1969 100 Plus
Dsp1-PD 386 CG12223-PD 8..386 19..397 1969 100 Plus
Dsp1-PC 385 CG12223-PC 5..385 17..397 1968 99.5 Plus
Dsp1-PE 393 CG12223-PE 118..338 6..252 171 23.4 Plus
Dsp1-PG 386 CG12223-PG 111..331 6..252 171 23.4 Plus
Dsp1-PD 386 CG12223-PD 111..331 6..252 171 23.4 Plus
Dsp1-PG 386 CG12223-PG 6..241 125..342 166 23.2 Plus
Dsp1-PD 386 CG12223-PD 6..241 125..342 166 23.2 Plus