Clone RE10028 Report

Search the DGRC for RE10028

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:100
Well:28
Vector:pFlc-1
Associated Gene/Transcriptbeat-IIb-RB
Protein status:RE10028.pep: wuzgold
Sequenced Size:2402

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4135 2007-09-25 DGC5 pick
beat-IIb 2008-04-29 Release 5.5 accounting
beat-IIb 2008-04-29 Picked prior to 5.5
beat-IIb 2008-08-15 Release 5.9 accounting
beat-IIb 2008-12-18 5.12 accounting

Clone Sequence Records

RE10028.complete Sequence

2402 bp assembled on 2007-11-08

GenBank Submission: BT031152

> RE10028.complete
AGTCGCAATTCTGACGATTGCGTGACGCGTTCGCATCGCGGCGATGAAAG
AGACAGAATATCTCGCGAGGAAAGAGATCGAAATAGTGGCGGGCATAAAG
TTTGAGTTTGACGTGCAAAATATAAATGAAAATTCACAAACAACTAATCG
AAATACGTAATAAAGTGTGTGCCAACTCTGAGAAATATTTGAAAAATATA
TTCGTATAAATTACCAACGAACCACGGACACAAGCGGTCTGTCTCTGGGA
ATAATATAAATTAGCATAATTTAGCAAGGATTTGCCGAGACAAGCAGACA
TTCGTTTCGCACTTAATTAGTGTCCAAGCGCGTTGACAATGTGGCAGACA
CTATCAACTTTTAGCACATCACTCAGAGCAGCAGCAGCAGCAGTGGCAGC
ACAACCAGCAGCAACTTGCAACTGTAGCTGCAAGCTGGAAAACGCGGAAA
TGCACAGTCACATGTTGCCATCAGCAGAGATTGCGACAACGGCAGTGCGT
AGGTGTTGCTGTCGCACAAAAATCACCCGCAGCAACAGCAGCAACTATAG
TTGCAACTACGGCAGCAACGTGATCCAGTGGCTACTGCTACTGTGCCTTT
TCTGTGATTTTGGCCAGGCCGCGCTGCGTGACGTAAATCTGCTGGTGGAG
CCTCCGGCGGTGCGAAGGGGTCAGTCTGTGGCCCTGCGGTGCGATTACCA
ATTGGTGGAGGCGCCCCTGTATTCCATTAAGTTTTACCGCGGCCAGATGG
AATTCTACCGCTACACACCAGGCGAGTATCCGCCAACCAAGGTCTTTCAG
TTCCCCGGCATCAGAGTGGACGAGAACGGCTCGAATGCCACCACCGTGCT
CATCCGCAACGTTAGCTTCGGCCTGTCCGGACAATTCAGCTGCGAGGTTA
CGGCGGATGCCCCGCTCTATTCCACGGCCACAGCCTTCGCCCAGATGCAA
GTTGTGGAATTTCCGGAGAAGCGACCGCAGCTTTTTACGGAACACTCGCG
ATACGAACCAGGAGATGTTTTGCGTGCAAATTGCAGTACTTTGCCATCTC
GGCCTCGAGCTGATCTTCGTTTCACCATCAACAATATTCCCGTCAGCACG
GAGGAAACGCAGTACATTCGAACGGTTGACAGCCTGATTGCATCCCGGCT
CAGTCTGAAGCTGCAGCTGCAGGCGACTCACTTTGTGGCTGGGCTCAGTG
CCCATGGAAATGGGAACGGGAATGGTAATGGCAATGGAAATGGCAACGGC
AATGGCCTGGCGAACGCACTGCACCTGGGTGGCGGCGGCGGAGGCGCTGG
AGGCGGAGGACTCATCCTGCGTTGTACGGCGCAAATTGGCGATCTCTATC
AGGAGTACAAGGAAATAGAGCTGGGCACACCGCAAAAGGATCCGGTGCCG
GCCAGAGGTAAGCCTCAAAAGGATAACTGCCGACAGCCACGAAGCACTGA
AAAGAAAATATTTCCGTAAACAAGCAAACTGATTTAAAGACGATTTAAAT
TTAAAAGCGCTCAGCATAGAATCCCTCTTTTCAATTTGTTTATCTAACTT
TGATCTAGTTTCTTTTCAAATTATTATATAAAACTTCTTTAATTTATCTA
ATGAGCTTAAGAAATATCTAGTGTTTCCAAATCGGGTTAGAACCTAAAAA
AAAAATATTTATTTTTATTTCCTAAGTAAATTATACTGCTATTAAATCTC
TCTCTGTAAAAATGCATTTGTTGGCCATTGCAGTGACGCTGTCATCAGGA
ACCGGACTGCGTGGCTTCTTGGAGACCTATTTCGCTACATCTTCGGGCCC
CAGCAATTGGCGGGGATCGGCAGGGGTCGTGGCCATCTTCCTGCCCACTG
CGTTGGCCCAACTAATTACTGGTAGCTAAATCGGGGGCCAGTCGGCTGGA
ATTTGGGGACATGGACTTGGAATGCGAACGTGTGTCGGCTTATCGAGCTG
CGATGGAAATTAGGGAGCCCTCGGCCGTAAACTGCATTATTTATCTGTAT
CGAATGCAATTTAAATTTATACACATGCAGGACATGTCCGTGTGATTCCC
GGTTAAGACCACACATGCACACACAAACCCTACGTAACTGTAAATATTTG
CTTTAATGATGTGAACGGATACACTTAAATGAACTCGCACTCACACTCAC
GCGCTCACATACACAGAAACACGCGACTAATTGTTAATTAATGGATTATT
TAATGATGCATAAAATATTGGATAAAATATTAATGTTTCATTTGCATTTA
GCTTCAACCCAAGCGAATATCAACTTAATGTTTAAGTAATTTAAAAAATG
TAAATCGTTGAAACGATAGAAATATGAAAAACAGAAAAGTGTAAGCAACA
GAAATGAAATGCCAATGCCAAGACAAAACCAAAACCAAAAAAAAAAAAAA
AA

RE10028.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-RB 2498 beat-IIb-RB 65..2466 1..2402 11995 99.9 Plus
beat-IIb.a 2840 beat-IIb.a 407..2808 1..2402 11995 99.9 Plus
beat-IIb.c 1891 beat-IIb.c 1..1093 1..1093 5465 100 Plus
beat-IIb.c 1891 beat-IIb.c 1415..1891 1732..2208 2385 100 Plus
beat-IIb.c 1891 beat-IIb.c 1106..1416 1097..1407 1555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13056700..13057994 2386..1092 6460 99.9 Minus
chr3R 27901430 chr3R 13071739..13072344 606..1 2910 98.7 Minus
chr3R 27901430 chr3R 13064139..13064355 822..606 1085 100 Minus
chr3R 27901430 chr3R 13063925..13064060 957..822 680 100 Minus
chr3R 27901430 chr3R 13063358..13063494 1093..957 670 99.3 Minus
chr3R 27901430 chr3R 13145627..13145712 1412..1327 280 88.4 Minus
chr3R 27901430 chr3R 13156905..13157062 811..654 220 75.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-RC 1215 CG4135-PC 1..1069 339..1407 5345 100 Plus
beat-IIb-RA 1224 CG4135-PA 1..1078 339..1407 5205 99.1 Plus
beat-IIb-RC 1215 CG4135-PC 1068..1215 1732..1879 740 100 Plus
beat-IIb-RA 1224 CG4135-PA 1077..1224 1732..1879 740 100 Plus
beat-IIa-RB 1296 CG14334-PB 232..614 654..1036 415 73.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:32:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-RC 2442 CG4135-RC 383..1789 1..1407 7035 100 Plus
beat-IIb-RA 2070 CG4135-RA 2..1417 1..1407 6895 99.3 Plus
beat-IIb-RC 2442 CG4135-RC 1788..2442 1732..2386 3275 100 Plus
beat-IIb-RA 2070 CG4135-RA 1416..2070 1732..2386 3275 100 Plus
beat-IIa-RB 2829 CG14334-RB 983..1365 654..1036 415 73.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-PC 404 CG4135-PC 1..356 339..1406 1449 100 Plus
beat-IIb-PA 407 CG4135-PA 1..359 339..1406 1435 99.2 Plus
beat-IIa-PB 431 CG14334-PB 56..319 588..1406 858 65.2 Plus
beat-IIa-PA 431 CG14334-PA 56..319 588..1406 858 65.2 Plus
beat-Ia-PA 427 CG4846-PA 25..210 618..1187 390 43.2 Plus
beat-IIb-PC 404 CG4135-PC 357..404 1733..1876 240 100 Plus
beat-IIb-PA 407 CG4135-PA 360..407 1733..1876 240 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17232237..17233547 2402..1092 6540 99.9 Minus
3R 32079331 3R 17247271..17247876 606..1 3030 100 Minus
3R 32079331 3R 17239692..17239908 822..606 1085 100 Minus
3R 32079331 3R 17238911..17239047 1093..957 685 100 Minus
3R 32079331 3R 17239478..17239613 957..822 680 100 Minus
3R 32079331 3R 17321211..17321296 1412..1327 280 88.4 Minus
3R 32079331 3R 17332505..17332662 811..654 220 75.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16973068..16974378 2402..1092 6540 99.9 Minus
3R 31820162 3R 16988102..16988707 606..1 3030 100 Minus
3R 31820162 3R 16980523..16980739 822..606 1085 100 Minus
3R 31820162 3R 16979742..16979878 1093..957 685 100 Minus
3R 31820162 3R 16980309..16980444 957..822 680 100 Minus
3R 31820162 3R 17062042..17062127 1412..1327 280 88.3 Minus
3R 31820162 3R 17073336..17073493 811..654 220 75.9 Minus
Blast to na_te.dros performed 2014-11-27 11:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6708..6938 351..588 201 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2337..2567 367..598 185 56.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2272..2421 425..569 171 60.3 Plus
roo 9092 roo DM_ROO 9092bp 1041..1151 448..560 163 62.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6710..6832 456..580 142 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2635..2880 363..597 141 58.1 Plus
roo 9092 roo DM_ROO 9092bp 1101..1148 522..569 141 77.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2312..2367 514..569 136 71.4 Plus
roo 9092 roo DM_ROO 9092bp 1096..1136 529..569 133 80.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6767 515..569 131 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6829 469..568 131 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6788..6842 515..569 131 70.9 Plus
blood 7410 blood BLOOD 7410bp 6559..6625 1597..1530 129 71 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2604..2826 349..569 128 53.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6788 522..569 123 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6762..6809 522..569 123 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6776 514..569 120 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6746..6797 515..569 115 70.9 Plus

RE10028.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:40:20 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13071739..13072344 1..606 92   Minus
chr3R 13064140..13064354 607..821 100 <- Minus
chr3R 13063925..13064060 822..957 100 <- Minus
chr3R 13063360..13063493 958..1091 99 <- Minus
chr3R 13056742..13057994 1092..2344 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:47:13 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RA 1..1078 339..1407 99 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:06:06 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RB 1..1131 339..1469 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:44:04 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RC 1..1069 339..1407 100 == Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:52:25 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RA 1..1078 339..1407 99 == Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:40:20 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RC 1..1069 339..1407 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:47:13 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RA 1..1416 1..1407 99 == Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:06:06 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RB 1..2386 1..2386 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:44:04 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RC 1790..2442 1734..2386 100   Plus
beat-IIb-RC 383..1789 1..1407 100 == Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:52:25 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RA 1..1416 1..1407 99 == Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:40:20 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
beat-IIb-RC 1790..2442 1734..2386 100   Plus
beat-IIb-RC 383..1789 1..1407 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:40:20 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17247271..17247876 1..606 100   Minus
3R 17239693..17239907 607..821 100 <- Minus
3R 17239478..17239613 822..957 100 <- Minus
3R 17238913..17239046 958..1091 100 <- Minus
3R 17232253..17233547 1092..2386 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:44:04 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13072993..13073598 1..606 100   Minus
arm_3R 13065415..13065629 607..821 100 <- Minus
arm_3R 13065200..13065335 822..957 100 <- Minus
arm_3R 13064635..13064768 958..1091 100 <- Minus
arm_3R 13057975..13059269 1092..2386 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:58:20 Download gff for RE10028.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16988102..16988707 1..606 100   Minus
3R 16980524..16980738 607..821 100 <- Minus
3R 16980309..16980444 822..957 100 <- Minus
3R 16979744..16979877 958..1091 100 <- Minus
3R 16973084..16974378 1092..2386 100 <- Minus

RE10028.pep Sequence

Translation from 338 to 1468

> RE10028.pep
MWQTLSTFSTSLRAAAAAVAAQPAATCNCSCKLENAEMHSHMLPSAEIAT
TAVRRCCCRTKITRSNSSNYSCNYGSNVIQWLLLLCLFCDFGQAALRDVN
LLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRYTPGEYPPT
KVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAF
AQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNI
PVSTEETQYIRTVDSLIASRLSLKLQLQATHFVAGLSAHGNGNGNGNGNG
NGNGNGLANALHLGGGGGGAGGGGLILRCTAQIGDLYQEYKEIELGTPQK
DPVPARGKPQKDNCRQPRSTEKKIFP*

RE10028.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 21:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16887-PA 410 GF16887-PA 1..361 1..356 1190 69.1 Plus
Dana\GF16886-PA 428 GF16886-PA 36..326 61..363 937 63 Plus
Dana\GF14936-PA 424 GF14936-PA 25..251 94..357 439 37.1 Plus
Dana\GF14966-PA 317 GF14966-PA 27..227 94..274 383 42.1 Plus
Dana\GF14934-PA 454 GF14934-PA 44..282 81..349 373 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 21:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16782-PA 418 GG16782-PA 1..370 1..356 1382 87.4 Plus
Dere\GG16781-PA 429 GG16781-PA 62..319 90..356 920 67 Plus
Dere\GG25189-PA 431 GG25189-PA 26..251 95..357 422 36.5 Plus
Dere\GG24184-PA 330 GG24184-PA 29..227 96..274 387 42.5 Plus
Dere\GG25187-PA 550 GG25187-PA 55..281 90..349 366 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 21:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17501-PA 363 GH17501-PA 45..314 92..356 1070 78.2 Plus
Dgri\GH17500-PA 448 GH17500-PA 51..320 81..356 952 65.8 Plus
Dgri\GH11350-PA 665 GH11350-PA 9..204 94..285 393 43 Plus
Dgri\GH10395-PA 348 GH10395-PA 2..207 116..357 379 33.9 Plus
Dgri\GH10393-PA 462 GH10393-PA 33..241 75..284 370 38.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 21:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-PC 404 CG4135-PC 1..356 1..356 1875 100 Plus
beat-IIb-PA 407 CG4135-PA 1..359 1..356 1861 99.2 Plus
beat-IIa-PB 431 CG14334-PB 56..319 84..356 901 65.7 Plus
beat-IIa-PA 431 CG14334-PA 56..319 84..356 901 65.7 Plus
beat-Ia-PA 427 CG4846-PA 25..261 94..367 398 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 21:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22830-PA 450 GI22830-PA 1..397 1..356 1080 60.9 Plus
Dmoj\GI22828-PA 437 GI22828-PA 56..319 82..356 949 65.9 Plus
Dmoj\GI17373-PA 402 GI17373-PA 9..248 80..357 438 36 Plus
Dmoj\GI12934-PA 279 GI12934-PA 6..217 82..285 396 41 Plus
Dmoj\GI17370-PA 549 GI17370-PA 36..252 75..285 361 37.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 21:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23946-PA 407 GL23946-PA 1..365 42..356 1063 69.2 Plus
Dper\GL23945-PA 439 GL23945-PA 61..318 90..356 923 68.3 Plus
Dper\GL21040-PA 402 GL21040-PA 8..234 94..357 445 36.7 Plus
Dper\GL15307-PA 1184 GL15307-PA 26..317 52..343 401 34.6 Plus
Dper\GL15323-PA 351 GL15323-PA 29..222 96..285 391 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 21:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17980-PA 390 GA17980-PA 1..342 42..356 1095 73.2 Plus
Dpse\GA27119-PA 437 GA27119-PA 61..318 90..356 923 68.1 Plus
Dpse\GA18474-PA 402 GA18474-PA 8..234 94..357 445 36.7 Plus
Dpse\GA20502-PA 624 GA20502-PA 290..495 87..285 398 41.4 Plus
Dpse\GA29045-PA 580 GA29045-PA 44..288 75..349 378 34.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 21:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15375-PA 402 GM15375-PA 1..354 1..356 1522 93.1 Plus
Dsec\GM15371-PA 431 GM15371-PA 62..319 90..356 925 67 Plus
Dsec\GM18652-PA 429 GM18652-PA 25..261 94..367 425 36.1 Plus
Dsec\GM17922-PA 327 GM17922-PA 29..227 96..274 382 42 Plus
Dsec\GM18650-PA 590 GM18650-PA 37..337 75..349 382 32 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 21:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20241-PA 400 GD20241-PA 1..352 1..356 1527 93.6 Plus
Dsim\GD20239-PA 431 GD20239-PA 62..319 90..356 925 67 Plus
Dsim\GD24038-PA 429 GD24038-PA 25..261 94..367 425 36.1 Plus
Dsim\GD21931-PA 327 GD21931-PA 29..227 96..274 387 42.5 Plus
Dsim\GD24036-PA 540 GD24036-PA 37..281 75..349 385 34.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 21:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22830-PA 430 GJ22830-PA 96..383 61..356 1041 75.3 Plus
Dvir\GJ22829-PA 394 GJ22829-PA 24..276 90..356 932 67.4 Plus
Dvir\GJ18052-PA 381 GJ18052-PA 10..230 95..352 429 37.2 Plus
Dvir\GJ18050-PA 568 GJ18050-PA 63..257 95..285 361 37.8 Plus
Dvir\GJ16186-PA 370 GJ16186-PA 79..287 81..285 324 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 21:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11458-PA 403 GK11458-PA 106..359 90..356 1084 77.3 Plus
Dwil\GK11457-PA 414 GK11457-PA 41..305 82..356 926 65.8 Plus
Dwil\GK18108-PA 411 GK18108-PA 17..253 83..357 440 35.6 Plus
Dwil\GK24261-PA 405 GK24261-PA 130..323 96..285 396 42.4 Plus
Dwil\GK24768-PA 518 GK24768-PA 21..227 82..285 376 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 21:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24174-PA 404 GE24174-PA 1..356 1..356 1422 87.2 Plus
Dyak\GE24173-PA 433 GE24173-PA 62..318 90..356 931 66.7 Plus
Dyak\GE21310-PA 427 GE21310-PA 25..251 94..357 425 36.7 Plus
Dyak\GE19377-PA 330 GE19377-PA 29..227 96..274 389 42.5 Plus
Dyak\GE21288-PA 546 GE21288-PA 37..281 75..349 380 33.8 Plus

RE10028.hyp Sequence

Translation from 338 to 1468

> RE10028.hyp
MWQTLSTFSTSLRAAAAAVAAQPAATCNCSCKLENAEMHSHMLPSAEIAT
TAVRRCCCRTKITRSNSSNYSCNYGSNVIQWLLLLCLFCDFGQAALRDVN
LLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRYTPGEYPPT
KVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAF
AQMQVVEFPEKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNI
PVSTEETQYIRTVDSLIASRLSLKLQLQATHFVAGLSAHGNGNGNGNGNG
NGNGNGLANALHLGGGGGGAGGGGLILRCTAQIGDLYQEYKEIELGTPQK
DPVPARGKPQKDNCRQPRSTEKKIFP*

RE10028.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
beat-IIb-PC 404 CG4135-PC 1..356 1..356 1875 100 Plus
beat-IIb-PA 407 CG4135-PA 1..359 1..356 1861 99.2 Plus
beat-IIa-PB 431 CG14334-PB 56..319 84..356 901 65.7 Plus
beat-IIa-PA 431 CG14334-PA 56..319 84..356 901 65.7 Plus
beat-Ia-PA 427 CG4846-PA 25..261 94..367 398 36.1 Plus