Clone RE10877 Report

Search the DGRC for RE10877

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:108
Well:77
Vector:pFlc-1
Associated Gene/TranscriptCG17683-RC
Protein status:RE10877.pep: gold
Sequenced Size:1855

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17683-RC 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE10877.complete Sequence

1855 bp assembled on 2011-01-03

GenBank Submission: BT125993.1

> RE10877.complete
GTTCCACAATTACCGCTATGTTTTGACGATAGCTTGGCTCACTGCACTAA
ATATTTGAATAAGTTCAGAAAGCGGTTTGGTGAATATATAAAATAAAAAG
TTAAATATTATTTATTACGAAAACCATGTCGAGGTTGAGCAGAGCGCTGC
AGCTTACAGATATAGATGATTTTATTACGCCCTCACAGCCCGTGCAAATA
GATAAGGCAAGGTCAAAGACTGGGGCAAAGATAAAGATAAAAGGTGACGG
CTGCTTTGAGGAATCAGAGAGTGGAAATCTAAAACTTAATAAAGTTGATA
TTTCTCTGCAAGACTGTCTTGCGTGTTCTGGTTGCATCACTTCAGCTGAA
GAAGTCCTTATCACGCAGCAGAGCCGAGAAGAGTTGCTTAAGGTCCTTCA
AGAGAATTCAAAGAATAAGGCCTCTGAAGACTGGGATAACGTGCGTACGA
TCGTGTTCACCCTTGCCACCCAGCCTATACTAAGCTTAGCCTATCGCTAT
CAGATAGGTGTGGAGGATGCTGCCCGTCATCTTAATGGGTATTTTCGCAG
TTTGGGTGCCGACTATGTTTTGTCCACTAAGGTGGCGGACGATATTGCGC
TGCTCGAATGTCGTCAAGAATTTGTAGATAGGTACCGCGAAAATGAGAAC
TTGACCATGCTTAGCTCCTCTTGTCCGGGGTGGGTTTGTTACGCGGAGAA
AACACACGGAAACTTCTTATTGCCTTACGTTTCCACGACCCGATCTCCTC
AGCAAATAATGGGAGTGCTTGTGAAGCAAATCCTTGCCGATAAGATGAAT
GTTCCTGCGTCACGAATCTACCATGTGACCGTGATGCCTTGCTACGACAA
GAAGCTTGAGGCCTCTCGAGAGGACTTTTTCAGCAAGGCAAATAACTCAC
GCGACGTAGACTGTGTAATCACTTCAGTTGAGGTGGAACAGTTGCTTAGT
GAGGCTCAGCAGCCGCTGTCGCAGTACGATCTCCTTGATTTAGACTGGCC
ATGGTCTAATGTACGCCCAGAATTCATGGTATGGGCTCACGAGAAGACGC
TATCTGGCGGTTACGCAGAACACATATTTAAGTACGCCGCAAAACATATT
TTCAACGAAGATTTAAAAACAGAGTTGGAATTCAAACAGCTCAAAAACCG
CGACTTTAGAGAAATTATACTTAAACAGAATGGCAAAACTGTCCTGAAAT
TTGCAATTGCTAACGGTTTCCGGAACATACAAAACTTGGTACAAAAACTG
AAGCGTGAAAAGGTATCAAATTACCACTTTGTTGAGGTAATGGCCTGTCC
CTCGGGCTGTATAAACGGAGGAGCACAAATACGTCCCACTACCGGACAGC
ACGTTCGCGAGCTTACCCGGAAACTGGAGGAATTATACCAGAATCTTCCA
CGGTCCGAACCCGAAAACTCCTTAACAAAACATATTTACAATGACTTTTT
AGACGGCTTTCAAAGTGATAAATCATATGACGTGCTGCACACCCGTTACC
ATGATGTAGTATCTGAGCTCAGTATATCGCTTAATATAAATTGGTAAACG
TATTGTGCTTGATTATCTCTTTTAGTATATCGACAGTTTCGGTAAAGGAA
TAAGGCCCACAAACAAATATTTAAAATTAAAAAAAAAAAACTCATTTAAA
CGGGGTGAGATTAGTGACAATACCGTTTTAAACCCAAAAACTGTATGAAT
AACGAATAATATGATAAAATAGATTTTTCATTTATTTATAAACTATTTTC
GGGAAATCTAAAATTTTCAAATAAAAAAATTGTTCAGTCTGGGCTGTTTA
ATAAAAAATGGAGGTACCAGTAGAAAAAAAAAAAAAAATAAAAAAAAAAA
AAAAA

RE10877.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19538..20436 925..1824 4450 99.9 Plus
chr2R 21145070 chr2R 18824..19483 268..927 3300 100 Plus
chr2R 21145070 chr2R 18441..18628 1..188 940 100 Plus
chr2R 21145070 chr2R 18690..18772 187..269 415 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-RC 1422 CG17683-PC 1..1422 126..1547 7110 100 Plus
CG17683-RA 1434 CG17683-PA 1..1434 126..1547 6955 99.2 Plus
CG17683-RD 1293 CG17683-PD 14..1293 268..1547 6400 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-RC 1785 CG17683-RC 1..1785 38..1823 8880 99.9 Plus
CG17683-RA 1696 CG17683-RA 1..1696 38..1722 8220 99.2 Plus
CG17683-RD 2403 CG17683-RD 296..1851 268..1824 7735 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-PC 473 CG17683-PC 1..473 126..1544 2462 100 Plus
CG17683-PA 477 CG17683-PA 1..477 126..1544 2447 99.2 Plus
CG17683-PD 430 CG17683-PD 5..430 267..1544 2223 99.8 Plus
CG17683-PE 296 CG17683-PE 1..296 657..1544 1567 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4132034..4132932 925..1824 4450 99.9 Plus
2R 25286936 2R 4131320..4131979 268..927 3300 100 Plus
2R 25286936 2R 4130937..4131124 1..188 940 100 Plus
2R 25286936 2R 4131186..4131268 187..269 415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 4133233..4134131 925..1824 4460 99.8 Plus
2R 25260384 2R 4132519..4133178 268..927 3300 100 Plus
2R 25260384 2R 4132136..4132323 1..188 940 100 Plus
2R 25260384 2R 4132385..4132467 187..269 415 100 Plus
Blast to na_te.dros performed 2014-11-27 16:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 1846..1893 68..115 132 75 Plus

RE10877.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:57:51 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19541..20435 928..1823 99   Plus
chr2R 18826..19483 270..927 100 -> Plus
chr2R 18692..18772 189..269 100 -> Plus
chr2R 18441..18628 1..188 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-05 09:01:19 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 1..1422 126..1547 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:38:39 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 1..1422 126..1547 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:57:51 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 1..1422 126..1547 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 09:01:19 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 1..1822 1..1823 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:38:39 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 1..1785 38..1823 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:57:51 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG17683-RC 1..1785 38..1823 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:57:51 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4132037..4132931 928..1823 99   Plus
2R 4131322..4131979 270..927 100 -> Plus
2R 4131188..4131268 189..269 100 -> Plus
2R 4130937..4131124 1..188 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:38:39 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19542..20436 928..1823 99   Plus
arm_2R 18827..19484 270..927 100 -> Plus
arm_2R 18693..18773 189..269 100 -> Plus
arm_2R 18442..18629 1..188 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:54:08 Download gff for RE10877.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4133236..4134130 928..1823 99   Plus
2R 4132521..4133178 270..927 100 -> Plus
2R 4132387..4132467 189..269 100 -> Plus
2R 4132136..4132323 1..188 100 -> Plus

RE10877.pep Sequence

Translation from 125 to 1546

> RE10877.pep
MSRLSRALQLTDIDDFITPSQPVQIDKARSKTGAKIKIKGDGCFEESESG
NLKLNKVDISLQDCLACSGCITSAEEVLITQQSREELLKVLQENSKNKAS
EDWDNVRTIVFTLATQPILSLAYRYQIGVEDAARHLNGYFRSLGADYVLS
TKVADDIALLECRQEFVDRYRENENLTMLSSSCPGWVCYAEKTHGNFLLP
YVSTTRSPQQIMGVLVKQILADKMNVPASRIYHVTVMPCYDKKLEASRED
FFSKANNSRDVDCVITSVEVEQLLSEAQQPLSQYDLLDLDWPWSNVRPEF
MVWAHEKTLSGGYAEHIFKYAAKHIFNEDLKTELEFKQLKNRDFREIILK
QNGKTVLKFAIANGFRNIQNLVQKLKREKVSNYHFVEVMACPSGCINGGA
QIRPTTGQHVRELTRKLEELYQNLPRSEPENSLTKHIYNDFLDGFQSDKS
YDVLHTRYHDVVSELSISLNINW*

RE10877.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22738-PA 476 GF22738-PA 1..476 1..473 1806 69 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21400-PA 477 GG21400-PA 1..477 1..473 2231 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10760-PA 476 GH10760-PA 1..476 1..473 1863 70.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-PC 473 CG17683-PC 1..473 1..473 2462 100 Plus
CG17683-PA 477 CG17683-PA 1..477 1..473 2447 99.2 Plus
CG17683-PD 430 CG17683-PD 5..430 48..473 2223 99.8 Plus
CG17683-PE 296 CG17683-PE 1..296 178..473 1567 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11683-PA 476 GI11683-PA 1..476 1..473 1922 72.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21135-PA 477 GL21135-PA 1..477 1..473 1950 75.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29080-PA 477 GA29080-PA 1..477 1..473 1950 75.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20417-PA 478 GM20417-PA 1..478 1..473 2446 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17698-PA 288 GD17698-PA 1..268 1..264 1360 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13047-PA 476 GJ13047-PA 1..476 1..473 1911 72.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14772-PA 477 GK14772-PA 1..477 1..473 1940 74.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22682-PA 477 GE22682-PA 1..477 1..473 2291 88.3 Plus

RE10877.hyp Sequence

Translation from 125 to 1546

> RE10877.hyp
MSRLSRALQLTDIDDFITPSQPVQIDKARSKTGAKIKIKGDGCFEESESG
NLKLNKVDISLQDCLACSGCITSAEEVLITQQSREELLKVLQENSKNKAS
EDWDNVRTIVFTLATQPILSLAYRYQIGVEDAARHLNGYFRSLGADYVLS
TKVADDIALLECRQEFVDRYRENENLTMLSSSCPGWVCYAEKTHGNFLLP
YVSTTRSPQQIMGVLVKQILADKMNVPASRIYHVTVMPCYDKKLEASRED
FFSKANNSRDVDCVITSVEVEQLLSEAQQPLSQYDLLDLDWPWSNVRPEF
MVWAHEKTLSGGYAEHIFKYAAKHIFNEDLKTELEFKQLKNRDFREIILK
QNGKTVLKFAIANGFRNIQNLVQKLKREKVSNYHFVEVMACPSGCINGGA
QIRPTTGQHVRELTRKLEELYQNLPRSEPENSLTKHIYNDFLDGFQSDKS
YDVLHTRYHDVVSELSISLNINW*

RE10877.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG17683-PC 473 CG17683-PC 1..473 1..473 2462 100 Plus
CG17683-PA 477 CG17683-PA 1..477 1..473 2447 99.2 Plus
CG17683-PD 430 CG17683-PD 5..430 48..473 2223 99.8 Plus
CG17683-PE 296 CG17683-PE 1..296 178..473 1567 100 Plus