Clone RE12958 Report

Search the DGRC for RE12958

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:129
Well:58
Vector:pFlc-1
Associated Gene/Transcriptdap-RA
Protein status:RE12958.pep: gold
Sequenced Size:1670

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
dap-ra 2010-04-28 Manual selection by Sue Celniker

Clone Sequence Records

RE12958.complete Sequence

1670 bp assembled on 2010-08-13

GenBank Submission: BT125118.1

> RE12958.complete
CGTGAAATTTCACTTTTGAACGCAGCAAGACGTAAAATAAGCTGCAGCAC
AACGCACACACAGAACACTCGCTCTCCCTCTCACATACACACACGCTCGC
GTGTGGAGACCGTGATTTGTATTCGTGTGGAGACTGCCTCTCTCTCTTTT
GGGGCTGTCTGAACACAAAGTTTTGGCGCCAAAAGTTTGACAGTTCGCTT
TGGCGTGTAATTCGCAAACAAGTGGCAAGAAAAGTGCGTCTCAAAACAGA
GTAGAAAACACTAGGGGATCCCAAAAAAATATATATTGACTCAACATGGT
CAGTGCCCGAGTCCTGAATCCTGTGATGATCAGTGAGTTCTGCAAGATGA
GCAGCAGCCCGGCGGTGAGTCGCAATCTGGCATGCGGTCGTCAGTTGAAT
CGCATAAAGCGTGACCTCTTCGGTAGCTCCAAATCCGCCGAGGGTACAGC
CAACAAAACACCCTTTAATTCCGAACTGGAGCGCCATCAAGAACTGGCCA
CGCAAAAATGGGGCTTTGACTTCCGCGCCGGCTGCCCTTTAGCTGAAAAA
TCACCCTACATTTGGGAGCGCGTCAGCTTCCAGGAGTCGAGCTTCGCCCC
AGAGATGTACACCCTAACACGGGCCGCCCACGTACGCCCTTCCGCGGATG
CAAGTCCTAGCGACATGGACATTTTGGTCAACGAGCGCTCAGAACGGGAG
AACTTTGGCTCCAATCTGGTCAATTCCTCGCTAGAGTCGAACACGGATAA
TGAATCTTGTTACGACTCCCAGGACGAGTCGCTGGCAATGCGGCTTAGCT
CCTCCAGCACGACAAGCACATCCTCCATAGTCCTGCGCAAGAGACAGCCA
AAAATCACAGAATTCATGAAGGAGCGCAAACGTCTGGCCCAGGCACCCAA
GAAACTATCGCCCGCAAAGCGCATGCGCACCAGTTCTCCCAGTTCGTCCG
CCACTTCCAGCTCCAGCTCCAGCGGTGGATTTGGGTTGGGGGCACACTTT
GGGGCGATGTTGAAGCGGCCGCGCCACAACTAATGCTCCAGATTCGCTGG
CCAACCCACCGAATTGCAATTTGTAATTTTATTTTTTACAAGCCACTGCG
ATTGTGTAGTATTTCCTAATTTTTTATTACGAACCTTTTTATGCAGTGCA
AGGGCGACAGTTGCGAATATTAATCGTTAGTCTTCAACTACTCGTAACCA
GTAATTAGTTGTAAGTCAACCAGTAAGCTCGAGCTAAATGAAACTTTTTA
GATTTCTCTAGTGAGAAATGCCATAAACTAAGTGATTAGTTCTTAACAAC
AAACAACTATTGAACAAGAAGAGAGAGACCGCAAGCTAAATGGAATTAGT
CTTAACTATCTTGAAGCCAACCGAAATTTAACCTTTATAACGATGGAATA
CTAACTTTACATAACTTTGTGAAATCCTTGCAAATTTCGCCGGCAACTTT
TGCATTTGAAATTTGCCGGGTGAACAAAACTCATCCTTTCTCTGCCCTGC
CACTTCATCCAAGTACTGAAACTGAGGGGAGAGTAGAATTGAGTTTTGTC
TTGCATATTAAGGGCGCCAAAACGATGCCCCAATAAGCCGCATTTCGGCT
CATTGCTGCTTTGTTTTTGCGACCTACTAACATTGTAACCAATTCGACCA
GTGGAAAAAAAAAAAAAAAA

RE12958.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5602357..5603154 857..1654 3990 100 Plus
chr2R 21145070 chr2R 5600095..5600553 1..459 2295 100 Plus
chr2R 21145070 chr2R 5600613..5601013 460..860 2005 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
dap-RA 738 CG1772-PA 1..738 296..1033 3690 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
dap-RA 2530 CG1772-RA 325..1978 1..1654 8270 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
dap-PA 245 CG1772-PA 1..245 296..1030 1115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9714907..9715720 857..1670 4055 99.9 Plus
2R 25286936 2R 9712645..9713103 1..459 2295 100 Plus
2R 25286936 2R 9713163..9713563 460..860 2005 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9716106..9716919 857..1670 4055 99.8 Plus
2R 25260384 2R 9713844..9714302 1..459 2295 100 Plus
2R 25260384 2R 9714362..9714762 460..860 2005 100 Plus
Blast to na_te.dros performed on 2014-11-27 04:10:11 has no hits.

RE12958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:38:11 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5602361..5603154 861..1654 100   Plus
chr2R 5600613..5601013 460..860 100 -> Plus
chr2R 5600095..5600553 1..459 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-13 13:13:08 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 1..738 296..1033 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:47 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 1..738 296..1033 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:28:21 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 1..738 296..1033 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:38:11 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 1..738 296..1033 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-13 13:13:08 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 323..1976 1..1654 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:47 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 323..1976 1..1654 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:28:21 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 325..1978 1..1654 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:38:11 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
dap-RA 325..1978 1..1654 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:38:11 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9714911..9715704 861..1654 100   Plus
2R 9713163..9713563 460..860 100 -> Plus
2R 9712645..9713103 1..459 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:28:21 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5602416..5603209 861..1654 100   Plus
arm_2R 5600668..5601068 460..860 100 -> Plus
arm_2R 5600150..5600608 1..459 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:44 Download gff for RE12958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9716110..9716903 861..1654 100   Plus
2R 9714362..9714762 460..860 100 -> Plus
2R 9713844..9714302 1..459 100 -> Plus

RE12958.pep Sequence

Translation from 295 to 1032

> RE12958.pep
MVSARVLNPVMISEFCKMSSSPAVSRNLACGRQLNRIKRDLFGSSKSAEG
TANKTPFNSELERHQELATQKWGFDFRAGCPLAEKSPYIWERVSFQESSF
APEMYTLTRAAHVRPSADASPSDMDILVNERSERENFGSNLVNSSLESNT
DNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQA
PKKLSPAKRMRTSSPSSSATSSSSSSGGFGLGAHFGAMLKRPRHN*

RE12958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13384-PA 237 GF13384-PA 1..237 1..245 988 81.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24100-PA 245 GG24100-PA 1..245 1..245 1138 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22938-PA 233 GH22938-PA 1..233 1..245 644 58 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
dap-PA 245 CG1772-PA 1..245 1..245 1242 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18426-PA 253 GI18426-PA 1..253 1..245 551 53.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17154-PA 244 GL17154-PA 1..244 1..245 948 74 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14624-PA 244 GA14624-PA 1..244 1..245 942 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21147-PA 195 GM21147-PA 1..192 1..192 940 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10678-PA 243 GD10678-PA 1..243 1..245 1142 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\dap-PA 251 GJ21511-PA 1..251 1..245 652 59.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15955-PA 213 GK15955-PA 2..213 24..245 695 66.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19298-PA 243 GE19298-PA 1..243 1..245 1095 91 Plus

RE12958.hyp Sequence

Translation from 295 to 1032

> RE12958.hyp
MVSARVLNPVMISEFCKMSSSPAVSRNLACGRQLNRIKRDLFGSSKSAEG
TANKTPFNSELERHQELATQKWGFDFRAGCPLAEKSPYIWERVSFQESSF
APEMYTLTRAAHVRPSADASPSDMDILVNERSERENFGSNLVNSSLESNT
DNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQA
PKKLSPAKRMRTSSPSSSATSSSSSSGGFGLGAHFGAMLKRPRHN*

RE12958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
dap-PA 245 CG1772-PA 1..245 1..245 1242 100 Plus