Clone RE13967 Report

Search the DGRC for RE13967

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:139
Well:67
Vector:pFlc-1
Associated Gene/Transcriptbap-RA
Protein status:RE13967.pep: gold
Sequenced Size:1468

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7902 2002-10-04 Blastp of sequenced clone
CG7902 2003-01-01 Sim4 clustering to Release 3
bap 2008-04-29 Release 5.5 accounting
bap 2008-08-15 Release 5.9 accounting
bap 2008-12-18 5.12 accounting

Clone Sequence Records

RE13967.complete Sequence

1468 bp (1468 high quality bases) assembled on 2002-10-04

GenBank Submission: BT001561

> RE13967.complete
ACATTCGCTGCGCAGCCCTCGAGTCGTGAAGATCGGAAAATCAATAGAAA
TCCGTAGTGAACAAGTGTCGGAAAGGCCAAAGACAATACCTATATATATA
TATCCGAAATATTCAGAAAATTCGAAAAATGCTGAATATGGAAAGCGCGG
GTGTCAGTGCTGCGATGGCGGGTCTGAGCAAATCGCTCACCACGCCCTTC
TCCATCAACGATATCCTAACGCGCAGCAATCCGGAAACACGTCGCATGTC
CAGCGTGGACTCCGAACCGGAACCGGAAAAGCTGAAACCCTCCTCCGATC
GCGAGCGATCGATCTCCAAGTCGCCGCCACTCTGCTGCCGAGATCTCGGC
CTCTACAAGCTGACCCAACCCAAGGAGATCCAACCAAGTGCCAGGCAACC
CAGCAACTATCTGCAGTATTATGCGGCGGCGATGGACAACAATAACCACC
ATCACCAGGCAACGGGCACATCGAACTCCAGTGCCGCCGACTACATGCAG
CGCAAATTGGCCTATTTTGGATCCACCCTCGCTGCTCCTTTGGACATGAG
ACGCTGCACCAGCAACGATTCCGACTGCGACTCACCACCGCCATTGAGCA
GTTCCCCCTCGGAGTCGCCGCTATCCCACGACGGCAGTGGATTGAGCCGC
AAGAAGCGGTCGCGTGCCGCCTTCAGCCACGCCCAGGTCTTCGAGTTGGA
GCGCCGCTTTGCCCAACAGCGCTACTTGTCCGGTCCGGAACGCAGCGAGA
TGGCCAAGAGCCTGCGCCTGACGGAGACCCAGGTGAAGATCTGGTTCCAA
AACCGCCGCTACAAGACCAAGCGCAAGCAGATCCAGCAGCACGAGGCCGC
CCTTTTGGGTGCCAGCAAGAGGGTTCCCGTCCAAGTCTTGGTGCGAGAGG
ATGGCAGCACCACCTACGCTCACATGGCTGCTCCCGGTGCTGGACACGGC
CTCGATCCCGCCCTGATCAACATCTACCGCCATCAGCTGCAGCTGGCCTA
CGGCGGACTTCCGCTGCCACAGATGCAGATGCCATTCCCGTACTTCTACC
CGCAACACAAGGTGCCGCAACCCATACCGCCACCAACCCAGAGTTCCAGC
TTTGTGACTGCATCCTCGGCGTCCTCATCGCCAGTTCCCATCCCCATCCC
GGGTGCAGTGCGTCCCCAGCGAACGCCGTGTCCCAGTCCCAATGGCCAGA
TGATGAGCGTCGAGAGCGGAGCGGAGAGCGTTCACTCGGCGGCGGAGGAT
GTTGACGAGAATGTGGAGATCGACTAGGTTGGGAGTGACCATGTCTCGGA
GGAGAACCGGGGCTACGTTTTTGTGATAGCCGTAGAAATTGCGTTTTAGC
CTCTATGTGTAACCAATAGATGTCCCATAGCTTTAGTAGCATTAAGTTGT
AGTCGTATCTACCCGAGAGCTAAATAAAATTATGAATTAAATAAAAAAAA
AAAAAAAAAAAAAAAAAA

RE13967.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
bagpipe-RA 1451 bagpipe-RA 5..1450 1..1446 7215 99.9 Plus
vnd-RB 2797 vnd-RB 1720..1778 765..823 205 89.8 Plus
vnd.d 3031 vnd.d 1954..2012 765..823 205 89.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17213400..17214269 573..1442 4335 99.9 Plus
chr3R 27901430 chr3R 17212707..17213279 1..573 2805 99.3 Plus
chrX 22417052 chrX 490892..490950 765..823 205 89.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
bap-RA 1149 CG7902-PA 1..1149 129..1277 5745 100 Plus
vnd-RB 1734 CG6172-PB 1309..1367 765..823 205 89.8 Plus
vnd-RA 2172 CG6172-PA 1747..1805 765..823 205 89.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:48 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
bap-RA 1449 CG7902-RA 8..1449 1..1442 7195 99.9 Plus
vnd-RB 3412 CG6172-RB 2147..2205 765..823 205 89.8 Plus
vnd-RA 3033 CG6172-RA 2100..2158 765..823 205 89.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
bap-PA 382 CG7902-PA 1..372 129..1244 1555 100 Plus
scro-PA 468 CG17594-PA 89..358 108..950 229 29.6 Plus
vnd-PB 577 CG6172-PB 394..496 639..896 228 51.5 Plus
vnd-PA 723 CG6172-PA 540..642 639..896 228 51.5 Plus
scro-PF 307 CG17594-PF 89..197 642..950 219 44.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21389580..21390453 573..1446 4355 99.9 Plus
3R 32079331 3R 21388887..21389459 1..573 2865 100 Plus
X 23542271 X 596886..596944 765..823 205 89.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21130411..21131284 573..1446 4355 99.8 Plus
3R 31820162 3R 21129718..21130290 1..573 2865 100 Plus
X 23527363 X 604984..605042 765..823 205 89.8 Plus
Blast to na_te.dros performed on 2014-11-27 13:01:03 has no hits.

RE13967.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:27:27 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17213401..17214269 574..1442 99   Plus
chr3R 17212707..17213279 1..573 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:55:53 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 1..1149 129..1277 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:12:48 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 1..1149 129..1277 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:27 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 1..1149 129..1277 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:03:40 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 1..1149 129..1277 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:27:27 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 1..1149 129..1277 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:35:12 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 5..1446 1..1442 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:12:48 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 5..1446 1..1442 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:27 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 8..1449 1..1442 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:03:40 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 5..1446 1..1442 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:27:27 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 8..1449 1..1442 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:27:27 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21389581..21390449 574..1442 99   Plus
3R 21388887..21389459 1..573 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:27 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17215303..17216171 574..1442 99   Plus
arm_3R 17214609..17215181 1..573 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:35:30 Download gff for RE13967.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21130412..21131280 574..1442 99   Plus
3R 21129718..21130290 1..573 100 -> Plus

RE13967.pep Sequence

Translation from 128 to 1276

> RE13967.pep
MLNMESAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPE
KLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAA
AMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDC
DSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYL
SGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVP
VQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQ
MPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTP
CPSPNGQMMSVESGAESVHSAAEDVDENVEID*

RE13967.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18600-PA 384 GF18600-PA 1..384 1..382 1525 88.1 Plus
Dana\vnd-PA 751 GF22099-PA 575..675 173..257 241 48.5 Plus
Dana\GF20558-PA 429 GF20558-PA 211..302 172..257 233 50 Plus
Dana\GF17487-PA 728 GF17487-PA 376..444 174..241 213 56.5 Plus
Dana\GF12182-PA 380 GF12182-PA 82..151 166..233 207 60 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24598-PA 382 GG24598-PA 1..382 1..382 1999 98.2 Plus
Dere\GG12796-PA 735 GG12796-PA 558..660 171..256 238 51.5 Plus
Dere\GG16309-PA 430 GG16309-PA 212..303 172..257 234 50 Plus
Dere\GG21357-PA 721 GG21357-PA 393..461 174..241 212 56.5 Plus
Dere\GG22042-PA 381 GG22042-PA 75..144 166..233 207 60 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22032-PA 406 GH22032-PA 1..406 4..382 1120 68 Plus
Dgri\GH24198-PA 743 GH24198-PA 574..673 173..257 235 50 Plus
Dgri\GH18027-PA 467 GH18027-PA 247..338 172..257 231 50 Plus
Dgri\GH13706-PA 752 GH13706-PA 380..471 154..241 212 47.8 Plus
Dgri\GH12767-PA 110 GH12767-PA 2..62 175..235 188 59 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
bap-PA 382 CG7902-PA 1..382 1..382 1985 100 Plus
Hmx-PD 718 CG43748-PD 319..623 41..318 244 29.4 Plus
scro-PA 468 CG17594-PA 113..358 21..274 239 30.8 Plus
Hmx-PE 592 CG43748-PE 319..558 41..261 239 31.6 Plus
Hmx-PC 592 CG43748-PC 319..558 41..261 239 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21951-PA 382 GI21951-PA 1..382 1..382 1045 62.9 Plus
Dmoj\GI14840-PA 762 GI14840-PA 594..692 173..256 244 50.5 Plus
Dmoj\GI23787-PA 466 GI23787-PA 246..348 172..275 235 47.3 Plus
Dmoj\GI24795-PA 307 GI24795-PA 165..239 160..233 226 62.7 Plus
Dmoj\GI24810-PA 787 GI24810-PA 418..486 174..241 215 56.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27337-PA 380 GL27337-PA 1..380 1..382 1310 78.7 Plus
Dper\GL13779-PA 324 GL13779-PA 5..132 144..261 247 48.8 Plus
Dper\GL21380-PA 740 GL21380-PA 560..659 173..257 239 49 Plus
Dper\GL12355-PA 467 GL12355-PA 112..340 21..257 218 32.5 Plus
Dper\GL24020-PA 773 GL24020-PA 414..482 174..241 213 56.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20672-PA 380 GA20672-PA 1..380 1..382 1309 77.7 Plus
Dpse\GA30058-PA 591 GA30058-PA 424..555 140..261 240 46.7 Plus
Dpse\vnd-PA 740 GA19408-PA 560..658 173..256 238 49.5 Plus
Dpse\GA21136-PA 761 GA21136-PA 403..471 174..241 213 56.5 Plus
Dpse\GA20934-PA 575 GA20934-PA 482..550 172..240 204 55.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\bap-PA 382 GM10423-PA 1..382 1..382 1810 97.4 Plus
Dsec\GM19075-PA 723 GM19075-PA 540..642 171..256 238 51.5 Plus
Dsec\GM15242-PA 280 GM15242-PA 121..204 160..243 228 57.1 Plus
Dsec\GM25858-PA 729 GM25858-PA 399..467 174..241 213 56.5 Plus
Dsec\GM22025-PA 378 GM22025-PA 75..144 166..233 207 60 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\bap-PA 382 GD19423-PA 1..382 1..382 1994 98.2 Plus
Dsim\GD16514-PA 723 GD16514-PA 540..642 171..256 239 51.5 Plus
Dsim\GD20427-PA 719 GD20427-PA 392..460 174..241 213 56.5 Plus
Dsim\GD11523-PA 378 GD11523-PA 75..150 166..239 208 56.6 Plus
Dsim\GD19422-PA 116 GD19422-PA 2..62 175..235 189 59 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14311-PA 392 GJ14311-PA 1..392 1..382 1020 62.1 Plus
Dvir\GJ19505-PA 713 GJ19505-PA 545..643 173..256 240 49.5 Plus
Dvir\GJ24443-PA 289 GJ24443-PA 147..253 160..261 224 50.9 Plus
Dvir\GJ24455-PA 758 GJ24455-PA 403..477 174..247 216 54.7 Plus
Dvir\GJ23616-PA 467 GJ23616-PA 110..351 21..277 212 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14503-PA 399 GK14503-PA 1..399 1..382 1171 68.9 Plus
Dwil\GK16436-PA 787 GK16436-PA 611..723 173..278 242 44.3 Plus
Dwil\GK18982-PA 233 GK18982-PA 69..165 143..233 239 53.6 Plus
Dwil\GK10842-PA 475 GK10842-PA 121..348 21..257 218 32.2 Plus
Dwil\GK12153-PA 788 GK12153-PA 425..493 174..241 215 58 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25732-PA 390 GE25732-PA 1..390 1..382 1733 91.5 Plus
Dyak\GE11056-PA 430 GE11056-PA 212..303 172..257 234 50 Plus
Dyak\GE25478-PA 262 GE25478-PA 123..228 160..261 219 49.5 Plus
Dyak\GE26456-PA 721 GE26456-PA 392..460 174..241 213 56.5 Plus
Dyak\GE12123-PA 380 GE12123-PA 75..144 166..233 208 60 Plus

RE13967.hyp Sequence

Translation from 128 to 1276

> RE13967.hyp
MLNMESAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPE
KLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAA
AMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDC
DSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYL
SGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVP
VQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQ
MPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTP
CPSPNGQMMSVESGAESVHSAAEDVDENVEID*

RE13967.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
bap-PA 382 CG7902-PA 1..382 1..382 1985 100 Plus
Hmx-PD 718 CG43748-PD 319..623 41..318 244 29.4 Plus
scro-PA 468 CG17594-PA 113..358 21..274 239 30.8 Plus
Hmx-PE 592 CG43748-PE 319..558 41..261 239 31.6 Plus
Hmx-PC 592 CG43748-PC 319..558 41..261 239 31.6 Plus