Clone RE14101 Report

Search the DGRC for RE14101

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:141
Well:1
Vector:pFlc-1
Associated Gene/TranscriptZasp66-RH
Protein status:RE14101.pep: gold
Sequenced Size:1134

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6416-RH 2009-06-22 Manual selection by Sue Celniker

Clone Sequence Records

RE14101.complete Sequence

1134 bp assembled on 2009-07-30

GenBank Submission: BT089012.1

> RE14101.complete
AGGTGCGTTCGGAATATTGAAAAATAAACAACAATAAGACTCGAGCTCGA
GCATCCTTTTTGTAGTGAATCCTAGTGTAAAGATCTCCGATCTCACCAGC
TGCAGCGTTGATTTAAACGTGACGAAGAAGAGTTTAAATTCAAACACAAA
ACACACACATTGCAAAAATGGAGTACGTTCAGTTCAAAAACGGATCCCCA
GTCTACTACAAGGAGCAGCCAGACCTCAATGAGTGCATTCAATACCAACC
CTACCGTACAACTCCGCTGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATG
CGCCCACGACAGAGTCCTACTTGAGGCACTACCCCAACCCGGCTGTGCGC
GCCCACCCAGGACACGACTACCATGACAGTATCATGAAGCAGCGCGTGGC
CGACACCATGCTGCACAAGGTGGTCGGTTCGGAAGCCGACACTGGCCGCG
TCTTCCACAAGCAATTCAACTCGCCCATTGGCCTGTACTCCAACAACAAC
ATCGAGGACACCATCAGATCCACAGTTCCAAACCAGTATCAGCGCCAGTA
TCCCGGCCGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCA
GAGCGGCTCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGT
ACTAGAAAGTGCAGCTGCAACACCAGCGACAGCAGCAACATCAACATCAA
CGCAACATCGGCAACATCTGCTGCACTTGTTTTATCTCCTAACATATTTA
GCGGATTTTTATGAAATTCTGTTTAACTTACTCAATAAATTATATGAAGA
ACGACAAGAAATTGTGAACCACTAACAAGCTTGATGATATAATGGATTGG
TAATCAATTGGCATCGAAATAAATTTACGATATAAACACCACTTAACGCC
GCCTCAACCTAATTACTGTCTGCACATGCAATAGAAAACGTATATAAATT
AATTAAATAAAAAAAAAAGGAAAGTAAAATTTGGTTTATAGTTATGTTTA
TGTTATGCTGATTCTAAGTTAACAGCCAGTCAGGCGTGTTAATACCGAGT
GATTCTAGTCATGGAATGTAATAGGTATTAAGAATGTTTTAATTAATAAA
AGTGACTTTGATTGGAAGAAAAAAAAAAAAAAAA

RE14101.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-RH 1260 Zasp66-RH 105..1226 4..1125 5565 99.7 Plus
Zasp66-RI 1390 Zasp66-RI 791..1386 530..1125 2935 99.4 Plus
Zasp66-RA 1401 Zasp66-RA 804..1399 530..1125 2935 99.4 Plus
Zasp66-RI 1390 Zasp66-RI 105..630 4..529 2630 100 Plus
Zasp66-RA 1401 Zasp66-RA 46..571 4..529 2630 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8630302..8630848 569..1116 2645 99.3 Plus
chr3L 24539361 chr3L 8626610..8626816 245..451 1005 99 Plus
chr3L 24539361 chr3L 8622282..8622408 4..130 635 100 Plus
chr3L 24539361 chr3L 8622548..8622666 130..248 595 100 Plus
chr3L 24539361 chr3L 8627036..8627112 453..529 370 98.7 Plus
chr3L 24539361 chr3L 8630192..8630233 530..571 210 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-RH 408 CG6416-PH 1..408 168..575 2040 100 Plus
Zasp66-RG 498 CG6416-PG 1..364 168..531 1820 100 Plus
Zasp66-RI 648 CG6416-PI 1..362 168..529 1810 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:35:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-RH 1120 CG6416-RH 9..1120 4..1115 5545 99.9 Plus
Zasp66-RO 1493 CG6416-RO 767..1493 249..975 3620 99.9 Plus
Zasp66-RB 1482 CG6416-RB 756..1482 249..975 3620 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-PH 135 CG6416-PH 1..130 168..557 709 100 Plus
Zasp66-PI 215 CG6416-PI 1..128 168..551 661 96.1 Plus
Zasp66-PG 165 CG6416-PG 1..121 168..530 656 100 Plus
Zasp66-PA 239 CG6416-PA 1..121 168..530 656 100 Plus
Zasp66-PJ 239 CG6416-PJ 1..121 168..530 656 100 Plus
Zasp66-PI 215 CG6416-PI 153..215 455..652 224 68.2 Plus
Zasp66-PA 239 CG6416-PA 177..239 455..652 224 68.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8638267..8638823 569..1125 2740 99.5 Plus
3L 28110227 3L 8634579..8634785 245..451 1020 99.5 Plus
3L 28110227 3L 8630251..8630377 4..130 635 100 Plus
3L 28110227 3L 8630517..8630635 130..248 595 100 Plus
3L 28110227 3L 8635002..8635081 450..529 400 100 Plus
3L 28110227 3L 8638157..8638198 530..571 210 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8631367..8631923 569..1125 2740 99.4 Plus
3L 28103327 3L 8627679..8627885 245..451 1020 99.5 Plus
3L 28103327 3L 8623351..8623477 4..130 635 100 Plus
3L 28103327 3L 8623617..8623735 130..248 595 100 Plus
3L 28103327 3L 8628102..8628181 450..529 400 100 Plus
3L 28103327 3L 8631257..8631298 530..571 210 100 Plus
Blast to na_te.dros performed 2014-11-27 07:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6828..6890 657..718 186 79.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2295..2371 649..725 177 73.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6804 646..725 167 70.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1512..1587 656..724 166 73.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6783 662..725 162 76.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2761..2840 648..726 155 71.1 Plus
roo 9092 roo DM_ROO 9092bp 1083..1154 648..718 150 69.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6753..6825 657..725 148 71.2 Plus
roo 9092 roo DM_ROO 9092bp 1092..1273 648..818 148 59.1 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3280..3345 657..721 147 71.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2404 662..725 142 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6774..6839 657..718 140 72.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2789..2854 661..725 138 69.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6794..6855 662..725 135 70.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2383..2461 648..725 133 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2632..2665 663..696 125 85.3 Plus
Doc3-element 4740 Doc3-element DOC3 4740bp 528..577 653..705 123 73.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2418..2484 643..715 117 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1541..1581 661..701 115 75.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2602..2665 648..707 112 68.8 Plus

RE14101.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:46:48 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8630302..8630393 569..660 100 == Plus
chr3L 8630192..8630230 530..568 100 -> Plus
chr3L 8627033..8627112 450..529 97 -> Plus
chr3L 8626614..8626814 249..449 99 -> Plus
chr3L 8622551..8622666 133..248 100 -> Plus
chr3L 8622279..8622411 1..132 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:24 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG6416-RA 1..357 168..524 100 -> Plus
CG6416-RA 590..720 525..655 96   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:19 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RA 590..720 525..655 96   Plus
Zasp66-RA 1..357 168..524 100 -> Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:52 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RH 1..408 168..575 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:46:48 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RH 1..408 168..575 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-30 17:04:37 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
CG6416-RH 3..957 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:18 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RH 41..998 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:52 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RH 6..963 1..958 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:46:48 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp66-RH 6..1120 1..1115 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:46:48 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8638267..8638816 569..1118 99   Plus
3L 8638157..8638195 530..568 100 -> Plus
3L 8635002..8635081 450..529 100 -> Plus
3L 8634583..8634783 249..449 100 -> Plus
3L 8630520..8630635 133..248 100 -> Plus
3L 8630248..8630380 1..132 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:52 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8631367..8631916 569..1118 99   Plus
arm_3L 8631257..8631295 530..568 100 -> Plus
arm_3L 8628102..8628181 450..529 100 -> Plus
arm_3L 8627683..8627883 249..449 100 -> Plus
arm_3L 8623620..8623735 133..248 100 -> Plus
arm_3L 8623348..8623480 1..132 97 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:12 Download gff for RE14101.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8631367..8631916 569..1118 99   Plus
3L 8631257..8631295 530..568 100 -> Plus
3L 8628102..8628181 450..529 100 -> Plus
3L 8627683..8627883 249..449 100 -> Plus
3L 8623620..8623735 133..248 100 -> Plus
3L 8623348..8623480 1..132 97 -> Plus

RE14101.pep Sequence

Translation from 167 to 574

> RE14101.pep
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPNQYQRQYPGRRTMW*

RE14101.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24342-PA 430 GF24342-PA 191..311 1..121 646 98.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14334-PA 429 GG14334-PA 191..311 1..121 653 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22528-PA 181 GH22528-PA 1..121 1..121 630 95 Plus
Dgri\GH15318-PA 149 GH15318-PA 5..31 95..121 134 92.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-PH 135 CG6416-PH 1..135 1..135 740 100 Plus
Zasp66-PI 215 CG6416-PI 1..133 1..133 664 93.2 Plus
Zasp66-PG 165 CG6416-PG 1..121 1..121 656 100 Plus
Zasp66-PA 239 CG6416-PA 1..121 1..121 656 100 Plus
Zasp66-PJ 239 CG6416-PJ 1..121 1..121 656 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12917-PA 429 GI12917-PA 191..311 1..121 635 95.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10326-PA 417 GL10326-PA 229..349 1..121 641 96.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19576-PA 240 GA19576-PA 1..121 1..121 636 96.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25076-PA 429 GM25076-PA 191..311 1..121 654 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13061-PA 429 GJ13061-PA 191..311 1..121 635 95.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16724-PA 243 GK16724-PA 1..121 1..121 634 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20762-PA 429 GE20762-PA 191..311 1..121 653 100 Plus

RE14101.hyp Sequence

Translation from 167 to 574

> RE14101.hyp
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPNQYQRQYPGRRTMW*

RE14101.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp66-PH 135 CG6416-PH 1..135 1..135 740 100 Plus
Zasp66-PI 215 CG6416-PI 1..133 1..133 664 93.2 Plus
Zasp66-PG 165 CG6416-PG 1..121 1..121 656 100 Plus
Zasp66-PA 239 CG6416-PA 1..121 1..121 656 100 Plus
Zasp66-PJ 239 CG6416-PJ 1..121 1..121 656 100 Plus