Clone RE15281 Report

Search the DGRC for RE15281

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:152
Well:81
Vector:pFlc-1
Associated Gene/TranscriptPapss-RD
Protein status:RE15281.pep: gold
Sequenced Size:2476

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Papss-RD 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE15281.complete Sequence

2476 bp assembled on 2009-10-01

GenBank Submission: BT099934.1

> RE15281.complete
GGGTGCAGTTTGGAGCTTCGGCGAGAAAGTTCAGCGTTTTCGGCGGTTGG
TTAACTTGGCTTTTCAACTGCGGAACTCTCACTTGTTTAATTATCAAAGA
GCGCACATTGTCCGATTCCCGCTTTCTTTTCACCTGCCCAACGTTTCGTT
TCGTTTTTGTTGGAAAATGTTTACCCGATGTGCCAATTCGCTTGGCCTCT
ACCATAATAATATTAACAATAACAACAGCGCTTGCTGTGCCGCTTCCCCG
AAAAGAAGCTGCCTTCCGAGTGTGGAAAAGCCTGAAGATGCGTGCCTACA
GGTGGCGACGAATGTGACCGAGCAAAAGCACCATGTCACCAGGGAGACGC
GCGGCAAGAATTTGGGACTCTGTCGAGGATTCCGAGGATGCACGGTGTGG
CTGACTGGCCTCAGTGGAGCTGGAAAGACCTCGATTGCCTTCGAACTGGA
GGCGTACCTGGTATCCCGGGGCATTCCGGCCTACGGGTTGGACGGCGACA
ACATTCGCACCGGACTGAACAAGAACCTGGGCTTCACGCCCGCCGATCGC
GAGGAAAACATTCGCCGCGTGGGCGAGGTGGCCAAGTTGTTTGCCGACAG
CGGAGTGGTGGCCATCTGCAGCTTCGTTTCGCCCTTCGCCGACGATCGTG
AGATGGCGCGCAAGATCCACAAGGATGCGGGTCTGAAGTTCTATGAGATA
TTCGTGGACACACCGCTGGATGTGTGCGAAACCCGGGACGTGAAGGGTCT
ATACAAGAAGGCGCGCGAGGGCGTAATCAAAGGATTCACGGGCATTACGC
AGGAGTACGAGCGACCCCAGATGCCGGAGCTGGTGGTCAACACGCACGGC
TACACGGTGCGCGAGTCCACTCAGAAGCTGGTGACGCTGCTCGAACAGGA
GGGCATTATTCCGCGCTCGCTGCGCGACGTAGACCTGCTGCCGGAGCTTT
ATCCCAGCGAATCCATTGCCACGGAGGCACTGCGTCACGAGGCCGAGTCG
CTGCAAGCCATCGAAATCAGCACCGTGGAGCTGCAGTGGGTGCAAGTACT
GGCCGAGGGATGGGCATATCCACTGCGCGGCTTCATGCGCGAGGATGAGT
ACCTGCAGACGCTGCACTTCAACACACTTCAGAGCGGCATGGACGGTTCC
TATCGCGAGAACCACTCGGTGCCCATTGTTTTGAGCGCCACGCAGGCGGA
CAAGGATCGTCTGGACGGCTGCTCCTCGCTGACTCTCAAATACCAAGGCA
AGGCGGTAGCCATTCTGCGGCGTCCCGAGTTCTACTTTCAGCGTAAGGAG
GAGCGGCTGGCCCGCCAGTTCGGCACCAGCAATCCCAATCACCCGTACAG
TAAGCAGGTCTACGAGTCCGGGGATTATTTGGTCGGTGGCGATCTGGCAG
TGATCGAACGTATCCGCTGGGAGGACGGACTGGATCAGTACAGGCTGACT
CCCAACGAGTTAAGGCGCCGCTTTAAGGAGCTGAATGCCGACGCCATCTT
CGCCTTTCAGTTGCGCAATCCCATCCACAACGGCCATGCCCTGCTCATGC
AAGACACTCGCCGCCAGCTGCTGGAGCGCGGCTTCAAGCAGCCAGTGCTG
CTGCTGCATCCTCTGGGTGGCTGGACCAAGGACGACGATGTGCCGCTGGA
TGTGCGCATGAAGCAGCACCAGGCCGTGCTCGACGCAGGTGTCTTGCGAC
GAGAGGACACAGTGCTGGCCATCTTCCCCTCGCCAATGATGTACGCCGGT
CCCACGGAGGTGCAGTGGCACGCAAAGGCGCGCATGAACGCCGGTGCGAA
CTTCTACATTGTAGGCCGTGATCCGGCTGGCATGCCGCATCCGGCCAAGG
AAACTTATCCGGATGGAAACCTATACGATGCCACCCATGGCGCGCGAGTG
CTTAAGATGGCCCAGGGACTAGACAGCATGGAGATCCTGCCCTTCCGTGT
TGCTGCCTATGACAAGAGCGCCAGTAGAATGGCCTTCTTCGAGCCCAAGA
GGAAGGATGAGTTTGAGTTCATCTCGGGAACCAAGATGCGCACCCTGGCC
AAAACGGGAGCCAGTCCGCCGGATGGCTTCATGGAACCGGAGGCTTGGCG
CATCCTGGCCACCTACTACCAGAACCTGCCGCAGTCGTAACCCGCTGCTC
ACACTCGATCCGCAACGTGCAATTCCTCCTAGTTATAGCTCGTGTGCTTA
TTATACATAAATATTTCAAGCTAAAGGCGCTTACCACTTACCACATCTTT
TTTCCATTGTTCTAAGCCGAAATCCGTGGCTGTCCCCGTGTGTGAATGTT
GTGCTCCTCCTAACTAAATGTTCGTATCGTACAATCTACTTGTATCTACA
CTTAAGTCACCCAATTCTTTTTATCTTAAGCAAAATATCGTGCAGCTATT
TTGTGGACGGTTTTTAATACATATATAAATAATAAAATAGAAAATTACTT
ATTGAAAAAGAAAAAAAAAAAAAAAA

RE15281.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RD 2578 Papss-RD 124..2576 4..2456 12250 99.9 Plus
Papss.e 2675 Papss.e 509..2673 292..2456 10810 99.9 Plus
Papss.a 2464 Papss.a 298..2462 292..2456 10810 99.9 Plus
Papss.e 2675 Papss.e 1..281 13..293 1405 100 Plus
Papss.a 2464 Papss.a 1..70 224..293 350 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19848178..19849704 407..1933 7575 99.7 Plus
chr3L 24539361 chr3L 19849765..19850289 1932..2456 2625 100 Plus
chr3L 24539361 chr3L 19836678..19836966 4..292 1430 99.7 Plus
chr3L 24539361 chr3L 19847741..19847857 292..408 585 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RD 1974 CG8363-PD 1..1974 167..2140 9855 99.9 Plus
Papss-RG 1890 CG8363-PG 41..1890 291..2140 9235 99.9 Plus
Papss-RB 1890 CG8363-PB 41..1890 291..2140 9235 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:37:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-RD 2457 CG8363-RD 7..2457 4..2454 12240 100 Plus
Papss-RG 2432 CG8363-RG 269..2432 291..2454 10805 100 Plus
Papss-RB 2394 CG8363-RB 231..2394 291..2454 10805 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PD 657 CG8363-PD 1..657 167..2137 3406 100 Plus
Papss-PG 629 CG8363-PG 7..629 269..2137 3228 99 Plus
Papss-PB 629 CG8363-PB 7..629 269..2137 3228 99 Plus
Papss-PA 629 CG8363-PA 7..629 269..2137 3228 99 Plus
Papss-PC 629 CG8363-PC 7..629 269..2137 3228 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19858814..19860340 407..1933 7620 99.9 Plus
3L 28110227 3L 19860403..19860927 1932..2456 2625 100 Plus
3L 28110227 3L 19847315..19847603 4..292 1445 100 Plus
3L 28110227 3L 19858377..19858493 292..408 585 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19851914..19853440 407..1933 7620 99.9 Plus
3L 28103327 3L 19853503..19854027 1932..2456 2625 100 Plus
3L 28103327 3L 19840415..19840703 4..292 1445 100 Plus
3L 28103327 3L 19851477..19851593 292..408 585 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:23:28 has no hits.

RE15281.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:53:00 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19849767..19850242 1934..2409 100 -> Plus
chr3L 19848179..19849704 408..1933 99 -> Plus
chr3L 19847742..19847856 293..407 100 -> Plus
chr3L 19836675..19836966 1..292 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:13:58 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 1..1974 167..2140 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:36:47 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 1..1974 167..2140 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:29 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 1..1974 167..2140 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:53:00 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 1..1974 167..2140 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:13:55 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 2..2455 1..2454 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:36:46 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 2..2455 1..2454 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:29 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 4..2457 1..2454 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:53:00 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
Papss-RD 4..2457 1..2454 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:53:00 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19860405..19860930 1934..2460 99   Plus
3L 19858815..19860340 408..1933 99 -> Plus
3L 19858378..19858492 293..407 100 -> Plus
3L 19847312..19847603 1..292 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:29 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19853505..19854030 1934..2460 99   Plus
arm_3L 19851915..19853440 408..1933 99 -> Plus
arm_3L 19851478..19851592 293..407 100 -> Plus
arm_3L 19840412..19840703 1..292 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:56 Download gff for RE15281.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19853505..19854030 1934..2460 99   Plus
3L 19851915..19853440 408..1933 99 -> Plus
3L 19851478..19851592 293..407 100 -> Plus
3L 19840412..19840703 1..292 99 -> Plus

RE15281.hyp Sequence

Translation from 0 to 2139

> RE15281.hyp
VAVWSFGEKVQRFRRLVNLAFQLRNSHLFNYQRAHIVRFPLSFHLPNVSF
RFCWKMFTRCANSLGLYHNNINNNNSACCAASPKRSCLPSVEKPEDACLQ
VATNVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELE
AYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADS
GVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGL
YKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQE
GIIPRSLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVL
AEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQAD
KDRLDGCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYS
KQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIF
AFQLRNPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLD
VRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGAN
FYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRV
AAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWR
ILATYYQNLPQS*

RE15281.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PD 657 CG8363-PD 1..657 56..712 3453 100 Plus
Papss-PG 629 CG8363-PG 7..629 90..712 3228 99 Plus
Papss-PB 629 CG8363-PB 7..629 90..712 3228 99 Plus
Papss-PA 629 CG8363-PA 7..629 90..712 3228 99 Plus
Papss-PC 629 CG8363-PC 7..629 90..712 3228 99 Plus

RE15281.pep Sequence

Translation from 1 to 2139

> RE15281.pep
GAVWSFGEKVQRFRRLVNLAFQLRNSHLFNYQRAHIVRFPLSFHLPNVSF
RFCWKMFTRCANSLGLYHNNINNNNSACCAASPKRSCLPSVEKPEDACLQ
VATNVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELE
AYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADS
GVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGL
YKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQE
GIIPRSLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVL
AEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQAD
KDRLDGCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYS
KQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIF
AFQLRNPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLD
VRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGAN
FYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRV
AAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWR
ILATYYQNLPQS*

RE15281.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23598-PA 629 GF23598-PA 7..629 90..712 3226 95.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16064-PA 629 GG16064-PA 7..628 90..711 3281 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14663-PA 629 GH14663-PA 9..629 92..712 3063 90.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Papss-PD 657 CG8363-PD 1..657 56..712 3453 100 Plus
Papss-PG 629 CG8363-PG 7..629 90..712 3228 99 Plus
Papss-PB 629 CG8363-PB 7..629 90..712 3228 99 Plus
Papss-PA 629 CG8363-PA 7..629 90..712 3228 99 Plus
Papss-PC 629 CG8363-PC 7..629 90..712 3228 99 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11647-PA 629 GI11647-PA 9..629 92..712 3057 90.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15741-PA 625 GL15741-PA 9..625 92..712 3045 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21020-PA 629 GA21020-PA 7..629 90..712 3124 92.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19669-PA 533 GM19669-PA 94..487 99..492 2088 99.5 Plus
Dsec\GM19674-PA 77 GM19674-PA 1..77 636..712 410 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14833-PA 595 GD14833-PA 7..595 90..712 3073 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11328-PA 630 GJ11328-PA 16..630 98..712 3059 91.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16974-PA 658 GK16974-PA 1..658 56..712 3157 89.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19629-PA 630 GE19629-PA 16..629 98..711 3293 99.8 Plus
Dyak\GE19630-PA 315 GE19630-PA 20..314 417..711 1593 99.7 Plus