Clone RE17490 Report

Search the DGRC for RE17490

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:174
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCG9249-RB
Protein status:RE17490.pep: gold
Sequenced Size:984

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9249 2003-01-01 Sim4 clustering to Release 3
CG9249 2004-10-27 Blastp of sequenced clone
CG9249 2008-04-29 Release 5.5 accounting
CG9249 2008-08-15 Release 5.9 accounting
CG9249 2008-12-18 5.12 accounting

Clone Sequence Records

RE17490.complete Sequence

984 bp (984 high quality bases) assembled on 2004-10-27

GenBank Submission: BT021305

> RE17490.complete
ATCAACGTTTGTTTTTCTCGCAAAAATGATGCGAAATGCCTTGTTAGTAA
GCGGCAAACTGAGACATTTGCTATCCTGTTCTATCGGGCGAAATTCGACT
AGAAGCAGCAGCACAGCGAAGTCGTTGGATGCCGGCACCCAAAAGGAAGT
GCGGCACCATGAGAATCACGCCTCGGAGTGGTGGAATCAAAATGGAACCA
TGGGTGCTCTACATGCCCTGAATGAGATTAGGGTTCCCTTTATCAGAGAT
GGCATCGTTTCGCGTGGCACTGTGAAGCCAGGTTACGTAAATACCACCAA
AGTGTTGTTGGGTCAAAATATTCTGGAGGTCGGATGTGGCGGAGGATTGC
TTACGGAACACTTGGCGCGCCTGGGTGCCCAGGTGGCTGGCATAGATCTT
GGCGAGAAGTTAATAGAAGCTGCTCGCGAGCATCTCAAATGCTCCAGTCC
GGAGTTGGCCAGCAATGTGGTGTACAAAATTGAGCCGGTGGATCAGCATG
CCAAGGCCAATTGCGAATGCTATGATGCGGTGATAGTGTCTGAAGTTCTG
GAGCACGTCAAAGATAAAGTGTCCCTGCTGGAGGCCAGTGTACGCAGCCT
AAAGCCTGGAGGATCCATCTTTATCACCACTTTGAACAAAACCATACCCA
GTTGGTTCGGTGGCGTGTTACTCAGCGAGTATGTTCTCAATCTGGTGCCC
AGGGGAACGCACCACTGGGACAAAATGATTTCGCCCTTGGACGTTCAGCG
CATCTTGGATACGATGAACTGTCAGACGGTGTTGGTAAATGGAAGCACCT
ACGACTTTTGGAGCAACACCTGGCGATGGATCAACAACAACCAGATGTGC
TACGCCTTGCAGGCGGTGAAACAAGCACAGCGCGAGTACAATTGAATTCG
TATATTTATTTAACTAAAAGCTAAGTCACGAGTGTAACAACTAAGTAGTA
AACTATTCGTCACCCGAGAAAAAAAAAAAAAAAA

RE17490.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-RB 1163 CG9249-RB 117..1084 1..968 4840 100 Plus
CG9249-RA 1140 CG9249-RA 31..794 1..764 3820 100 Plus
CG9249-RA 1140 CG9249-RA 858..1061 765..968 1020 100 Plus
Mpp6-RA 812 Mpp6-RA 571..774 968..765 1020 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21156216..21156750 764..230 2660 99.8 Minus
chr2L 23010047 chr2L 21155949..21156152 968..765 1020 100 Minus
chr2L 23010047 chr2L 21156808..21156986 232..54 895 100 Minus
chr2L 23010047 chr2L 21157040..21157093 54..1 270 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-RB 870 CG9249-PB 1..870 26..895 4350 100 Plus
CG9249-RA 933 CG9249-PA 1..739 26..764 3695 100 Plus
CG9249-RA 933 CG9249-PA 803..933 765..895 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:38:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-RB 991 CG9249-RB 24..991 1..968 4840 100 Plus
CG9249-RA 1065 CG9249-RA 24..787 1..764 3820 100 Plus
CG9249-RA 1065 CG9249-RA 851..1054 765..968 1020 100 Plus
Mpp6-RA 1335 CG9250-RA 1094..1297 968..765 1020 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-PB 289 CG9249-PB 1..289 26..892 1519 100 Plus
CG9249-PA 310 CG9249-PA 1..310 26..892 1483 92.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21157711..21158245 764..230 2675 100 Minus
2L 23513712 2L 21157444..21157647 968..765 1020 100 Minus
2L 23513712 2L 21158303..21158481 232..54 895 100 Minus
2L 23513712 2L 21158535..21158588 54..1 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21157711..21158245 764..230 2675 100 Minus
2L 23513712 2L 21157444..21157647 968..765 1020 100 Minus
2L 23513712 2L 21158303..21158481 232..54 895 100 Minus
2L 23513712 2L 21158535..21158588 54..1 270 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:53:39 has no hits.

RE17490.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:21:07 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21157040..21157093 1..54 100   Minus
chr2L 21156809..21156985 55..231 100 <- Minus
chr2L 21156216..21156748 232..764 99 <- Minus
chr2L 21155949..21156152 765..968 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:58:51 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RA 803..933 765..895 100   Plus
CG9249-RA 1..739 26..764 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:28:17 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 1..870 26..895 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:54:37 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 1..870 26..895 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:12:14 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RA 803..933 765..895 100   Plus
CG9249-RA 1..739 26..764 100 -> Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:07 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 1..870 26..895 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:31:47 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RA 1..764 1..764 100 -> Plus
CG9249-RA 828..1031 765..968 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:28:17 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 1..968 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:54:37 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 24..991 1..968 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:12:15 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RA 1..764 1..764 100 -> Plus
CG9249-RA 828..1031 765..968 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:07 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
CG9249-RB 24..991 1..968 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:21:07 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21158535..21158588 1..54 100   Minus
2L 21158304..21158480 55..231 100 <- Minus
2L 21157711..21158243 232..764 100 <- Minus
2L 21157444..21157647 765..968 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:54:37 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21158535..21158588 1..54 100   Minus
arm_2L 21158304..21158480 55..231 100 <- Minus
arm_2L 21157711..21158243 232..764 100 <- Minus
arm_2L 21157444..21157647 765..968 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:48:55 Download gff for RE17490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21158535..21158588 1..54 100   Minus
2L 21158304..21158480 55..231 100 <- Minus
2L 21157711..21158243 232..764 100 <- Minus
2L 21157444..21157647 765..968 100 <- Minus

RE17490.hyp Sequence

Translation from 0 to 894

> RE17490.hyp
STFVFLAKMMRNALLVSGKLRHLLSCSIGRNSTRSSSTAKSLDAGTQKEV
RHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTK
VLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSP
ELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSL
KPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQR
ILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVKQAQREYN*

RE17490.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-PB 289 CG9249-PB 1..289 9..297 1519 100 Plus
CG9249-PA 310 CG9249-PA 1..310 9..297 1483 92.9 Plus

RE17490.pep Sequence

Translation from 1 to 894

> RE17490.pep
STFVFLAKMMRNALLVSGKLRHLLSCSIGRNSTRSSSTAKSLDAGTQKEV
RHHENHASEWWNQNGTMGALHALNEIRVPFIRDGIVSRGTVKPGYVNTTK
VLLGQNILEVGCGGGLLTEHLARLGAQVAGIDLGEKLIEAAREHLKCSSP
ELASNVVYKIEPVDQHAKANCECYDAVIVSEVLEHVKDKVSLLEASVRSL
KPGGSIFITTLNKTIPSWFGGVLLSEYVLNLVPRGTHHWDKMISPLDVQR
ILDTMNCQTVLVNGSTYDFWSNTWRWINNNQMCYALQAVKQAQREYN*

RE17490.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 11:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19699-PA 259 GF19699-PA 1..259 17..272 1056 76.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 11:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21520-PA 289 GG21520-PA 1..289 9..297 1420 90.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 11:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13219-PA 295 GH13219-PA 1..291 9..296 1051 67 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG9249-PB 289 CG9249-PB 1..289 9..297 1519 100 Plus
CG9249-PA 310 CG9249-PA 1..310 9..297 1483 92.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 11:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14517-PA 286 GI14517-PA 1..284 9..295 1015 66.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 11:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25862-PA 244 GL25862-PA 1..242 14..254 955 75.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 11:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25472-PA 239 GA25472-PA 1..237 19..254 950 76.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 11:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23272-PA 259 GM23272-PA 1..245 9..254 1212 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 11:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21650-PA 288 GD21650-PA 1..288 9..297 1452 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 11:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16285-PA 293 GJ16285-PA 1..291 9..295 1056 67.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 11:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21052-PA 197 GK21052-PA 1..188 67..254 747 75 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 11:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13000-PA 289 GE13000-PA 1..289 9..297 1378 87.9 Plus