Clone RE18236 Report

Search the DGRC for RE18236

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:182
Well:36
Vector:pFlc-1
Associated Gene/Transcriptterm-RA
Protein status:RE18236.pep: gold
Preliminary Size:2321
Sequenced Size:1479

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4216 2001-12-14 Blastp of sequenced clone
CG4216 2002-01-01 Sim4 clustering to Release 2
CG4216 2003-01-01 Sim4 clustering to Release 3
term 2008-04-29 Release 5.5 accounting
term 2008-08-15 Release 5.9 accounting
term 2008-12-18 5.12 accounting

Clone Sequence Records

RE18236.complete Sequence

1479 bp (1479 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071151

> RE18236.complete
ATCACTCAGCAACTGAATCTTGCCATAGATACATCTCAGTGCTTCCGGAG
CAAACTGAAAGAGTAATCATCTATTTGTGCCTGAAATTGGTAAATCGTCC
AACAAAGCTATATCCACCTTTAGTTTTCGAATCCAAAGTTTCCATATCTC
AATCATGTTCGACGAGCCCATAATCTCCAGCTTCGTTTTTACCAACGAGG
AGACCACGCAGACATTCCACCACCAGTGGTTTTCCCAGGGCCAGTTACAC
GAATGTGCCACCTGCTACAGCTCCATCGACGCAGATGAGCCGCCCTCCCA
GCATTGGCTGCGGGGAGGAGAAGCATCACAGGGCTTGCATCTTACCAAGC
AACAGCAGGCCGTTATGGATATTATCGAGGCCCGCCAGATCGAGACTTTC
TTCTTCTGCGACGAGAGTTCCAAGGACAAGCTGGAACACTTCATGGGCGA
GACCTGTGCGAGGGGAATCCCCGAGCTTCTCCGCTGGATGTTCCAGAACA
ACACCGTGGCCGTGGAGTTCAATCTGGCCTGCTACGTGAACGCCATGGAC
CAGGTGTTGATCTTTCAGAGCGGCTCGCTGAGGGCGGACCACCACTACGA
CGTAGACGAATCCGTGGGCGTGGTCTACGAGATGCTTATGCAGAGGATTG
AAAACTACCTCAACTGCAGCAGCGAGTACGGCATGGCAGAGTGCAGCATC
ACCAGATTGAAAGTACAGGTGAAGAGGATTAGGGTGGAGGCGGACGGTCA
GTCAGCGGACTCGTCCGTCTTCGCCCTACCCCTGCAGCTTCAGGAGGAGG
AGGGCCTGACCGCCACTACCGGCTGCTCCACCAGCGAGGCAGAGCTTGCC
AGTCTGCGCTCCGCCTACCTGAAGCACTTCCGCGAGTGCAACGGCTACTT
CCCGCCCAACATGCGCGTCAATCTCTACGGACTGCAGCAGTGCAAGACCA
CCAAGGAGCTGTATGTGGTGCCCTATCATATCAGCGAAACCCTCCAGCAG
CTGCCCAACAAGAACTTCCTCATCCTGAACAATATCATGGGCCAATTCCA
GCGGCTCCACGAGCTCTCCACCCCCGTCAATTCCATCGAAAGGGATCAGA
CCAGCTCGCCGCTAAAGGACCTCCACTGCCGGAGGTGTCGCACCCAGTTC
TCGCGACGCAGCAAACTGCACATCCACCAGAAGCTGCGCTGTGGCCAGGA
CTTCTCCGTGGACAGCATGCACGCGGACATCGTGGAGATCTACGAGCAGT
GCCTGCCCATCTCGAGAAGCGTCTTCCAGCACGCCTGCTACGGCATCACC
AAGCCCAAGACCATGATGCGGAAGGGTCAGTTTGTGCCCATCGAGTGCGA
CTGGCGCAGCGAGAGCTCCGTGAAGGTGCAGCACGGCCCGTGTGTCGTCA
TCAGCAACGCCCAGCACAATAGTCCTTGTAAATTTTATTAAATAAACGAT
AACTTTTAAGCTGAAAAAAAAAAAAAAAA

RE18236.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
term-RA 1463 term-RA 1..1463 1..1463 7315 100 Plus
CG7271-RA 1403 CG7271-RA 48..1400 106..1461 6575 99.1 Plus
CG7271-RA 1403 CG7271-RA 1..45 1..45 165 91.1 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18581938..18583400 1463..1 7270 99.8 Minus
chr3L 24539361 chr3L 18578445..18579797 106..1461 6580 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
term-RA 1287 CG4216-PA 1..1287 155..1441 6435 100 Plus
CG7271-RA 1284 CG7271-PA 1..1284 155..1441 6235 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
term-RA 1469 CG4216-RA 7..1469 1..1463 7315 100 Plus
CG7271-RA 1407 CG7271-RA 52..1404 106..1461 6565 99.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
term-PA 428 CG4216-PA 1..428 155..1438 2285 100 Plus
CG7271-PA 427 CG7271-PA 1..427 155..1438 2240 98.8 Plus
CG6885-PA 378 CG6885-PA 7..377 176..1309 467 27.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18592300..18593765 1466..1 7330 100 Minus
3L 28110227 3L 18588810..18590162 106..1461 6565 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18585400..18586865 1466..1 7330 100 Minus
3L 28103327 3L 18581910..18583262 106..1461 6575 99.1 Plus
3L 28103327 3L 18581863..18581907 1..45 165 91.1 Plus
Blast to na_te.dros performed on 2014-11-26 20:06:08 has no hits.

RE18236.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:33:31 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18581938..18583400 1..1463 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:59:22 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1287 155..1441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:46 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1287 155..1441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:00:06 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1287 155..1441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:05 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1287 155..1441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:31 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1287 155..1441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:28 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1463 1..1463 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:46 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1463 1..1463 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:06 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 7..1469 1..1463 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:05 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 1..1463 1..1463 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:31 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
term-RA 7..1469 1..1463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:33:31 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18592303..18593765 1..1463 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:06 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18585403..18586865 1..1463 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:53 Download gff for RE18236.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18585403..18586865 1..1463 100   Minus

RE18236.pep Sequence

Translation from 154 to 1440

> RE18236.pep
MFDEPIISSFVFTNEETTQTFHHQWFSQGQLHECATCYSSIDADEPPSQH
WLRGGEASQGLHLTKQQQAVMDIIEARQIETFFFCDESSKDKLEHFMGET
CARGIPELLRWMFQNNTVAVEFNLACYVNAMDQVLIFQSGSLRADHHYDV
DESVGVVYEMLMQRIENYLNCSSEYGMAECSITRLKVQVKRIRVEADGQS
ADSSVFALPLQLQEEEGLTATTGCSTSEAELASLRSAYLKHFRECNGYFP
PNMRVNLYGLQQCKTTKELYVVPYHISETLQQLPNKNFLILNNIMGQFQR
LHELSTPVNSIERDQTSSPLKDLHCRRCRTQFSRRSKLHIHQKLRCGQDF
SVDSMHADIVEIYEQCLPISRSVFQHACYGITKPKTMMRKGQFVPIECDW
RSESSVKVQHGPCVVISNAQHNSPCKFY*

RE18236.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23638-PA 368 GF23638-PA 5..368 6..386 495 29.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15737-PA 427 GG15737-PA 1..427 1..428 2235 95.6 Plus
Dere\GG13660-PA 427 GG13660-PA 1..427 1..428 2235 95.6 Plus
Dere\GG13674-PA 374 GG13674-PA 7..374 8..386 489 28.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11100-PA 425 GH11100-PA 4..425 1..426 1513 67.8 Plus
Dgri\GH14371-PA 359 GH14371-PA 7..356 8..381 526 32.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
term-PA 428 CG4216-PA 1..428 1..428 2285 100 Plus
CG7271-PA 427 CG7271-PA 1..427 1..428 2240 98.8 Plus
CG6885-PA 378 CG6885-PA 7..377 8..385 467 27.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13592-PA 419 GI13592-PA 2..418 4..427 1444 68.2 Plus
Dmoj\GI11314-PA 369 GI11314-PA 7..367 8..381 488 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22878-PA 437 GL22878-PA 6..436 1..427 1833 77.8 Plus
Dper\GL24879-PA 235 GL24879-PA 3..234 144..387 304 29.8 Plus
Dper\GL20453-PA 139 GL20453-PA 7..128 8..126 157 29.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20226-PA 437 GA20226-PA 6..436 1..427 1835 78.1 Plus
Dpse\GA19930-PA 376 GA19930-PA 7..375 8..387 469 29 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14975-PA 427 GM14975-PA 1..427 1..428 2239 96.3 Plus
Dsec\GM14935-PA 427 GM14935-PA 1..427 1..428 2163 93.7 Plus
Dsec\GM14989-PA 378 GM14989-PA 7..377 8..385 481 27.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14752-PA 427 GD14752-PA 1..427 1..428 2245 96.5 Plus
Dsim\GD12340-PA 134 GD12340-PA 1..134 295..428 690 92.5 Plus
Dsim\GD12339-PA 134 GD12339-PA 1..118 1..119 619 96.6 Plus
Dsim\GD14766-PA 378 GD14766-PA 7..377 8..385 495 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13931-PA 421 GJ13931-PA 1..420 1..427 1588 68.6 Plus
Dvir\GJ11571-PA 367 GJ11571-PA 7..365 8..381 557 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11209-PA 434 GK11209-PA 1..434 1..428 1702 74 Plus
Dwil\GK12077-PA 382 GK12077-PA 5..378 5..381 463 29.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22069-PA 423 GE22069-PA 1..423 1..428 2214 95.6 Plus
Dyak\GE19957-PA 338 GE19957-PA 1..256 1..263 1144 83.7 Plus
Dyak\GE19957-PA 338 GE19957-PA 206..338 297..428 620 87.2 Plus
Dyak\GE19971-PA 378 GE19971-PA 7..374 8..382 481 28.4 Plus

RE18236.hyp Sequence

Translation from 154 to 1440

> RE18236.hyp
MFDEPIISSFVFTNEETTQTFHHQWFSQGQLHECATCYSSIDADEPPSQH
WLRGGEASQGLHLTKQQQAVMDIIEARQIETFFFCDESSKDKLEHFMGET
CARGIPELLRWMFQNNTVAVEFNLACYVNAMDQVLIFQSGSLRADHHYDV
DESVGVVYEMLMQRIENYLNCSSEYGMAECSITRLKVQVKRIRVEADGQS
ADSSVFALPLQLQEEEGLTATTGCSTSEAELASLRSAYLKHFRECNGYFP
PNMRVNLYGLQQCKTTKELYVVPYHISETLQQLPNKNFLILNNIMGQFQR
LHELSTPVNSIERDQTSSPLKDLHCRRCRTQFSRRSKLHIHQKLRCGQDF
SVDSMHADIVEIYEQCLPISRSVFQHACYGITKPKTMMRKGQFVPIECDW
RSESSVKVQHGPCVVISNAQHNSPCKFY*

RE18236.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
term-PA 428 CG4216-PA 1..428 1..428 2285 100 Plus
CG7271-PA 427 CG7271-PA 1..427 1..428 2240 98.8 Plus
CG6885-PA 378 CG6885-PA 7..377 8..385 467 27.9 Plus