Clone RE19116 Report

Search the DGRC for RE19116

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:191
Well:16
Vector:pFlc-1
Associated Gene/TranscriptE(spl)m3-HLH-RA
Protein status:RE19116.pep: gold
Preliminary Size:1422
Sequenced Size:1322

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8346 2002-01-01 Sim4 clustering to Release 2
CG8346 2002-03-28 Blastp of sequenced clone
CG8346 2003-01-01 Sim4 clustering to Release 3
HLHm3 2008-04-29 Release 5.5 accounting
HLHm3 2008-08-15 Release 5.9 accounting
HLHm3 2008-12-18 5.12 accounting

Clone Sequence Records

RE19116.complete Sequence

1322 bp (1322 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094858

> RE19116.complete
AGTCATTTCGTAAAAGTGCCGCCACTCGAACGCACCGCAATCGGTGGAAC
GCGCAACGCACGCGCAACAAACTCGTCAAAAAGTAACCAATCTATGAAAC
CAACCAAAATCAGTAGTGATAATGTGCAGTTGAGAGACTAAATACAAAAG
AACAATCCTTAAAGTACACAACATAAAACAACCCAATCGATCATGGTCAT
GGAGATGTCCAAGACGTATCAGTACCGCAAGGTGATGAAGCCGCTGCTGG
AGCGCAAACGGCGAGCCAGGATCAACAAGTGTCTGGACGATCTCAAGGAT
CTGATGGTGGAGTGCCTGCAGCAGGAGGGCGAGCACGTCACCCGGCTGGA
GAAGGCGGATATCCTGGAGTTGACCGTGGATCACATGAGGAAACTCAAGC
AGCGGGGTGGTCTTTCGCTGCAGGGAGTAGTGGCTGGTGTTGGCAGCCCA
CCCACCTCAACCAGTACCGCCCACGTGGAGTCCTTTCGCTCCGGCTATGT
GCATGCTGCCGATCAGATTACCCAGGTCCTGCTGCAGACACAGCAAACCG
ATGAGATTGGGCGCAAGATAATGAAATTCCTATCGACGCGACTAATTGAG
CTGCAGACGCAGTTGCTCCAGCAGCAGCAGCAACAGCAACAACACCAGCA
GCAGCAAATACCGCAATCATCAGGCCGCCTAGCCTTCCCGCTGCTGGGAG
GATATGGACCGGCAGCCGCCGCTGCCGCCATTAGTTACAGCTCCTTCCTG
ACCAGCAAGGACGAACTGATCGATGTGACATCCGTCGATGGCAATGCGTT
ATCCGAGACGGCGTCGGTTAGCTCGCAGGAGTCCGGCGCCTCTGAGCCCG
TCTGGAGGCCCTGGTAATTGGGCGTGCCCAATATGGATCTTATCCCTAAT
ATTATAATCGCAACCCAAAAAAATGGCTATTGACCGTTCTGCAACAAGAT
CCGTTGTCTTCCAAAGTAAATCATATCAACCTAAGTTAATTGAGGTCTAA
TCGATTTCTGAATGGTTTTGAAATACTTTTAGTTTTAGTTCCGATAATGG
TAATTTGTAAATTAATTGTTTAATTTCAACTGTGATATAACTAAAGTACG
TTGATCAATCAATCAGTGAATATATATTCGAGTGCGCTATTTTCCTACTC
CAAAAGTTCCCTAAGTTTAATATCTCGTTGCGCTCTCTTTATTGTTTAGC
ATATATTAAGCTTTAAATAATTTATAAATGTTAATTTATGATTAGTTGAG
AAAGAATAATCAAAAATACCCTACCCAAATAAAATAAATGATTTTAATTG
AAAAAAAAAAAAAAAAAAAAAA

RE19116.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
HLHm3-RA 1422 HLHm3-RA 116..1417 3..1304 6465 99.7 Plus
HLHmbeta-RA 1098 HLHmbeta-RA 143..336 199..392 640 88.6 Plus
HLHmgamma-RA 904 HLHmgamma-RA 107..213 202..308 340 87.8 Plus
HLHmgamma-RA 904 HLHmgamma-RA 230..273 325..368 160 90.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21844817..21846112 3..1300 6260 99.2 Plus
chr3R 27901430 chr3R 21828674..21828867 392..199 640 88.7 Minus
chr3R 27901430 chr3R 21822953..21823119 202..368 430 83.8 Plus
chr3R 27901430 chr3R 21860162..21860275 202..315 375 88.6 Plus
chr3R 27901430 chr3R 21820745..21820917 205..377 235 75.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m3-HLH-RA 675 CG8346-PA 1..675 193..867 3375 100 Plus
E(spl)mbeta-HLH-RA 588 CG14548-PA 13..206 199..392 640 88.7 Plus
E(spl)mgamma-HLH-RA 618 CG8333-PA 22..188 202..368 430 83.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:39:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m3-HLH-RA 1305 CG8346-RA 8..1305 3..1300 6445 99.8 Plus
E(spl)mbeta-HLH-RA 978 CG14548-RA 143..336 199..392 640 88.7 Plus
E(spl)mgamma-HLH-RA 911 CG8333-RA 114..280 202..368 430 83.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m3-HLH-PA 224 CG8346-PA 1..224 193..864 913 100 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 2..195 190..864 392 44.7 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 3..205 187..864 330 40.4 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 6..120 202..594 277 50.4 Plus
E(spl)mdelta-HLH-PA 173 CG8328-PA 9..101 205..510 235 51 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26021830..26023131 3..1304 6465 99.8 Plus
3R 32079331 3R 26005688..26005881 392..199 640 88.7 Minus
3R 32079331 3R 25999964..26000130 202..368 430 83.8 Plus
3R 32079331 3R 26037178..26037291 202..315 375 88.6 Plus
3R 32079331 3R 25997756..25997928 205..377 235 75.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25762661..25763962 3..1304 6465 99.7 Plus
3R 31820162 3R 25746519..25746712 392..199 640 88.6 Minus
3R 31820162 3R 25778009..25778122 202..315 375 88.5 Plus
3R 31820162 3R 25740795..25740901 202..308 340 87.8 Plus
3R 31820162 3R 25738587..25738693 205..311 220 80.3 Plus
3R 31820162 3R 25740918..25740961 325..368 160 90.9 Plus
Blast to na_te.dros performed on 2014-11-27 09:52:58 has no hits.

RE19116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:52:31 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21844815..21846112 1..1300 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:07 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
HLHm3-RA 1..675 193..867 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:23:40 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
HLHm3-RA 1..675 193..867 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:14:51 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m3-HLH-RA 1..675 193..867 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:54 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
HLHm3-RA 1..675 193..867 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:52:31 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m3-HLH-RA 1..675 193..867 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:50:32 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
HLHm3-RA 114..1413 1..1300 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:23:40 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
HLHm3-RA 114..1413 1..1300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:14:51 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m3-HLH-RA 6..1305 1..1300 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:54 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
HLHm3-RA 114..1413 1..1300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:52:31 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
E(spl)m3-HLH-RA 6..1305 1..1300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:52:31 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26021828..26023127 1..1300 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:14:51 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21847550..21848849 1..1300 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:50 Download gff for RE19116.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25762659..25763958 1..1300 99   Plus

RE19116.pep Sequence

Translation from 192 to 866

> RE19116.pep
MVMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVT
RLEKADILELTVDHMRKLKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRS
GYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQQQQQQQQ
HQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDG
NALSETASVSSQESGASEPVWRPW*

RE19116.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16799-PA 224 GF16799-PA 1..224 1..224 870 88 Plus
Dana\GF18225-PA 200 GF18225-PA 5..196 3..224 417 43.8 Plus
Dana\GF16796-PA 205 GF16796-PA 11..205 7..224 341 40.1 Plus
Dana\GF16801-PA 180 GF16801-PA 6..123 4..138 322 52.2 Plus
Dana\GF16795-PA 182 GF16795-PA 9..137 5..141 253 41.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11454-PA 226 GG11454-PA 1..226 1..224 1021 95.1 Plus
Dere\GG12207-PA 195 GG12207-PA 5..195 3..224 407 44.4 Plus
Dere\GG11450-PA 205 GG11450-PA 8..205 4..224 360 40.9 Plus
Dere\GG11458-PA 186 GG11458-PA 6..131 4..145 320 50.3 Plus
Dere\GG11449-PA 173 GG11449-PA 9..134 5..138 256 43 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19456-PA 228 GH19456-PA 1..228 1..224 790 82.7 Plus
Dgri\GH18148-PA 210 GH18148-PA 5..210 3..224 408 42.6 Plus
Dgri\GH19452-PA 217 GH19452-PA 11..135 7..138 349 58.6 Plus
Dgri\GH19458-PA 207 GH19458-PA 6..207 4..224 345 39.6 Plus
Dgri\GH19451-PA 198 GH19451-PA 9..158 5..141 245 38.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m3-HLH-PA 224 CG8346-PA 1..224 1..224 1125 100 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 5..195 3..224 422 45.5 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 8..205 4..224 353 42 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 6..186 4..224 323 38.5 Plus
E(spl)mdelta-HLH-PA 173 CG8328-PA 9..136 5..140 252 42.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24690-PA 229 GI24690-PA 1..229 1..224 816 81.5 Plus
Dmoj\GI22910-PA 210 GI22910-PA 5..210 3..224 402 42.3 Plus
Dmoj\GI24686-PA 217 GI24686-PA 6..217 2..224 374 41.7 Plus
Dmoj\GI24692-PA 207 GI24692-PA 6..130 4..138 323 51.5 Plus
Dmoj\GI24685-PA 185 GI24685-PA 9..185 5..224 252 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21819-PA 225 GL21819-PA 1..225 1..224 949 90.7 Plus
Dper\GL22021-PA 200 GL22021-PA 5..200 3..224 407 42.3 Plus
Dper\GL21815-PA 214 GL21815-PA 6..214 2..224 359 39.3 Plus
Dper\GL21822-PA 207 GL21822-PA 6..133 4..138 297 48.9 Plus
Dper\GL21813-PA 188 GL21813-PA 9..143 5..141 238 39.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21008-PA 219 GA21008-PA 1..219 1..224 947 90.6 Plus
Dpse\GA13073-PA 200 GA13073-PA 5..200 3..224 407 42.3 Plus
Dpse\GA20996-PA 214 GA20996-PA 6..214 2..224 358 39.4 Plus
Dpse\GA21018-PA 206 GA21018-PA 6..134 4..139 302 49.6 Plus
Dpse\GA20991-PA 188 GA20991-PA 9..143 5..141 238 39.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10297-PA 221 GM10297-PA 1..221 1..224 1033 97.8 Plus
Dsec\GM10206-PA 195 GM10206-PA 5..195 3..224 438 45 Plus
Dsec\GM10294-PA 205 GM10294-PA 8..205 4..224 361 40.9 Plus
Dsec\GM10299-PA 186 GM10299-PA 6..131 4..145 321 50.3 Plus
Dsec\GM10293-PA 173 GM10293-PA 9..134 5..138 256 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\HLHm3-PA 224 GD21261-PA 1..224 1..224 1180 100 Plus
Dsim\HLHmbeta-PA 195 GD18157-PA 5..195 3..224 407 44.4 Plus
Dsim\HLHmgamma-PA 205 GD21258-PA 8..205 4..224 361 40.9 Plus
Dsim\HLHm7-PA 186 GD21263-PA 6..131 4..145 319 50.3 Plus
Dsim\HLHmdelta-PA 173 GD21257-PA 9..134 5..138 256 43 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23906-PA 220 GJ23906-PA 1..220 1..224 814 84.1 Plus
Dvir\GJ23323-PA 209 GJ23323-PA 5..209 3..224 410 42.1 Plus
Dvir\GJ23903-PA 217 GJ23903-PA 6..217 2..224 383 42.6 Plus
Dvir\GJ23909-PA 197 GJ23909-PA 6..197 4..224 343 38.7 Plus
Dvir\GJ23902-PA 188 GJ23902-PA 9..149 5..142 267 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14458-PA 223 GK14458-PA 1..223 1..224 883 87.1 Plus
Dwil\GK12809-PA 201 GK12809-PA 5..201 3..224 385 41.7 Plus
Dwil\GK14455-PA 209 GK14455-PA 8..209 4..224 369 39.6 Plus
Dwil\GK14459-PA 200 GK14459-PA 6..165 4..172 343 48.3 Plus
Dwil\GK14454-PA 184 GK14454-PA 9..146 5..141 263 40.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23647-PA 224 GE23647-PA 1..224 1..224 1162 98.7 Plus
Dyak\HLHmbeta-PA 195 GE10652-PA 5..195 3..224 437 44.6 Plus
Dyak\HLHmgamma-PA 205 GE23644-PA 8..205 4..224 363 40.9 Plus
Dyak\HLHm7-PA 186 GE23649-PA 6..131 4..145 320 50.3 Plus
Dyak\HLHmdelta-PA 173 GE23643-PA 9..134 5..138 255 43 Plus

RE19116.hyp Sequence

Translation from 192 to 866

> RE19116.hyp
MVMEMSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVT
RLEKADILELTVDHMRKLKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRS
GYVHAADQITQVLLQTQQTDEIGRKIMKFLSTRLIELQTQLLQQQQQQQQ
HQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVTSVDG
NALSETASVSSQESGASEPVWRPW*

RE19116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
E(spl)m3-HLH-PA 224 CG8346-PA 1..224 1..224 1125 100 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 5..195 3..224 422 45.5 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 8..205 4..224 353 42 Plus
E(spl)m7-HLH-PA 186 CG8361-PA 6..186 4..224 323 38.5 Plus
E(spl)mdelta-HLH-PA 173 CG8328-PA 9..136 5..140 252 42.3 Plus