Clone RE20796 Report

Search the DGRC for RE20796

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:207
Well:96
Vector:pFlc-1
Associated Gene/Transcriptaz2-RA
Protein status:RE20796.pep: gold
Sequenced Size:1995

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1605 2003-01-01 Sim4 clustering to Release 3
az2 2008-04-29 Release 5.5 accounting
az2 2008-08-15 Release 5.9 accounting
az2 2008-12-18 5.12 accounting

Clone Sequence Records

RE20796.complete Sequence

1995 bp assembled on 2007-04-17

GenBank Submission: BT021301

> RE20796.complete
ATTGTATCTTATTTGTTTGTAAGCAAATCATGGTGGTTTGCGGGAACATT
TTGGCCAGGAACAACTTCGAGCACTTTGTTCTGGCGTGTGCTCACCAAAA
TGACTGCTACGTGGAGATGGAGTTCAAGCGGTGGCGAGAGTTCATCGTGC
ACGTCAAGGAGCACCTGGAAGCAAATCCAAGCATGCAGCAAGAGCTCACT
ACTTCCGAAGTCATTTCGTCAGCCAAATGCGAGGAGGAGGTCTCGCCAGC
CAAGGTGTTCATAGTGGAGGAGCCTCCGGAAAATTGCCTGGCTGAAGACA
TGTTCGTTGACGTGCCACCTTCATCAGAGAACGACGAGAGCACCAGCCCG
GTGGAGGAGGAGGAGGAAGAAGACGACGAGGTGGACTCCTCCTCGATGAC
AGTTGACTGCGAATTGGGCACCAGAAACTCCACACACTTTGCTCCTTTAA
CCAAATTCAATCCTACGTTTTACCGACGCAGTCCTCGGATCACACAGTTC
ATTGAACTGTATAAGCAGCAGACATGCCTCTGGGATCCAGCGGATGAGTC
GTACAGGGACAAGGAGAAACGCGCAAATGCCTATGAGGAGTTGCTGGAGC
AATTAAAGGCGACCGTCAATCTTCACCTAACGGCCTATAAGCTGAAGAAG
TGCATCACCAGCCTACACGCGCAGTATGCGTCGATCTCGCGGCAGAAGAA
AACTCAGAAACTAACCAAGGTTCCACTGTACTACCATGGAAAGTACAGCT
TTCTGGCAGAGCGCGGTAGTCTGGAGGATGCGGACAGCGATGATGTCGAC
GGCGATGGCAAAATAAAGCTGGTGTTCACAGAGGAGAATCAACTGACCAC
ACAGTTCATTGATTTGTACTCCAAGTTTCCCCAACTGTACGATCCCGCGC
ACAAGCACTTCTGCAATCTAAACGTACGAAAGTCATCGCTCATAGAGATC
ACTGACCTGCTGACTTCGGAGTTTTCGTTGGGCCTGGTCACCCACTACGA
TGTCTACGACAGTATTCAGAGCATGCGCCAATGGTATTCGCGACGGATCA
AAACCCTCACAGACGTCCAATGTGTGGGTCTCTCGCTGGCCGAGAAGCAG
TACATCGAGCGCTGCAATAGCTTTATGCCCACTAAATCATTCCGACAGAA
GCTTAAATGTGAAGTCTGCGAGCACTCCTTTAGCACAGATCACGCCCTGC
AAGCACATCAGTTCCGGGATCATAAGATGGGCGATGGAGGCTGGTTTCGC
TGCACGCTTTGCGAGCTGAACTTCGACCGAAAGTGTCACCTGCAGCAGCA
CAGCCAGCGTGTGCACATGGACAAGAGCTTTGTCTGCGAGATCTGCAGCA
GGAGCTTTGCCTTTGGAAATCAACTGGCTATCCACAAACGCACCCATGAC
GAGAAGCACGTCGCCAAGCCATTTGTCTGCGAGTTCTGCGGCAAGTGTTT
TAAGCAAAAAATCCAAATGACAACGCACGTAACTGCGGTTCACACCAAGA
TCCGAGCCTTCAAGTGCGACATGTGCCCCAAGGACTTCCTGACCAAGCGC
GACCTCAAGGACCACGTAAAGGCGCACCTGAACATCCGCGACAAGGTCTG
CGAGGTCTGTCAGAAGGCCTTCACCAATGCCAACGCCTTAGTCAAGCATC
GCCACATCCACAAGGAGAAGACCCTGCAATGTTCGCTCTGCACGACGCGC
TTCTCGGAGCGAGTTAGTCTTGGCGTCCACATGCGACGCACCCACAAGAT
CCTCAAGAGCTCTCTGTCGTCAAGCGACGCACTCTTTACAAAGACATTCC
CTCAGCCTTGAGACATTTCCAAACCATGACAAGTATTTACATTTGTTAAT
AACCAGAAAATATGGCTATAGTGCCAAAAAACATGAATTTTTTAATGTTC
TTAATGTATTATTACTCCTAAATATTTTTTAGTATTGAAACAAGAGATTT
TACAATATATTTGTCCAAGCTTGCAAAAATAAAAAAAAAAAAAAA

RE20796.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
az2-RA 2251 az2-RA 117..2107 1..1991 9925 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3397975..3399138 1980..817 5820 100 Minus
chr2R 21145070 chr2R 3399622..3400076 455..1 2275 100 Minus
chr2R 21145070 chr2R 3399193..3399555 818..456 1815 100 Minus
chr2R 21145070 chr2R 3404570..3404708 1601..1463 185 75.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
az2-RA 1782 CG1605-PA 1..1782 30..1811 8910 100 Plus
CG1602-RA 1734 CG1602-PA 1392..1530 1463..1601 185 75.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
az2-RA 2006 CG1605-RA 26..2005 1..1980 9900 100 Plus
CG1602-RA 1901 CG1602-RA 1468..1606 1463..1601 185 75.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
az2-PA 593 CG1605-PA 1..593 30..1808 2949 100 Plus
CG1602-PA 577 CG1602-PA 1..565 30..1763 967 37.8 Plus
CG1603-PB 586 CG1603-PB 187..586 453..1670 669 34.2 Plus
CG1603-PA 586 CG1603-PA 187..586 453..1670 669 34.2 Plus
rgr-PA 856 CG8643-PA 434..847 501..1745 359 25.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7510612..7511786 1991..817 5845 99.8 Minus
2R 25286936 2R 7512270..7512724 455..1 2275 100 Minus
2R 25286936 2R 7511841..7512203 818..456 1815 100 Minus
2R 25286936 2R 7517218..7517356 1601..1463 185 75.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7511811..7512985 1991..817 5845 99.8 Minus
2R 25260384 2R 7513469..7513923 455..1 2275 100 Minus
2R 25260384 2R 7513040..7513402 818..456 1815 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:22:52 has no hits.

RE20796.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:31:13 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3399622..3400076 1..455 100   Minus
chr2R 3399193..3399555 456..818 100 <- Minus
chr2R 3397975..3399136 819..1980 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:16 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1782 30..1811 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:19:02 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1782 30..1811 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:49:47 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1782 30..1811 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:15:27 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1782 30..1811 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:13 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1782 30..1811 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:34:45 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1980 1..1980 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:19:02 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1980 1..1980 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:47 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 26..2005 1..1980 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:15:28 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 1..1980 1..1980 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:13 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
az2-RA 26..2005 1..1980 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:13 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7512270..7512724 1..455 100   Minus
2R 7511841..7512203 456..818 100 <- Minus
2R 7510623..7511784 819..1980 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:47 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3399775..3400229 1..455 100   Minus
arm_2R 3399346..3399708 456..818 100 <- Minus
arm_2R 3398128..3399289 819..1980 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:08:01 Download gff for RE20796.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7513469..7513923 1..455 100   Minus
2R 7513040..7513402 456..818 100 <- Minus
2R 7511822..7512983 819..1980 100 <- Minus

RE20796.pep Sequence

Translation from 2 to 1810

> RE20796.pep
CILFVCKQIMVVCGNILARNNFEHFVLACAHQNDCYVEMEFKRWREFIVH
VKEHLEANPSMQQELTTSEVISSAKCEEEVSPAKVFIVEEPPENCLAEDM
FVDVPPSSENDESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLT
KFNPTFYRRSPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQ
LKATVNLHLTAYKLKKCITSLHAQYASISRQKKTQKLTKVPLYYHGKYSF
LAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAH
KHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIK
TLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQ
AHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSR
SFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKI
RAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHR
HIHKEKTLQCSLCTTRFSERVSLGVHMRRTHKILKSSLSSSDALFTKTFP
QP*

RE20796.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13673-PA 596 GF13673-PA 1..590 10..602 2274 71.3 Plus
Dana\GF13671-PA 532 GF13671-PA 1..519 10..586 950 36.2 Plus
Dana\GF13672-PA 581 GF13672-PA 1..578 10..556 734 30.8 Plus
Dana\GF12368-PA 877 GF12368-PA 452..866 166..581 355 27.1 Plus
Dana\GF17307-PA 433 GF17307-PA 1..396 10..424 333 25.3 Plus
Dana\GF12368-PA 877 GF12368-PA 675..825 443..596 192 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10738-PA 588 GG10738-PA 1..588 10..602 2839 89.2 Plus
Dere\GG10736-PA 543 GG10736-PA 1..539 10..594 969 37.1 Plus
Dere\GG10737-PA 586 GG10737-PA 1..584 10..554 690 29.7 Plus
Dere\GG23369-PA 859 GG23369-PA 433..850 163..581 347 27 Plus
Dere\GG17492-PA 897 GG17492-PA 459..887 161..579 303 24.1 Plus
Dere\GG23369-PA 859 GG23369-PA 659..809 443..596 194 29 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19813-PA 607 GH19813-PA 1..600 10..601 1949 60.1 Plus
Dgri\GH19811-PA 533 GH19811-PA 1..519 10..588 903 36.3 Plus
Dgri\GH19812-PA 505 GH19812-PA 1..489 10..550 673 30.5 Plus
Dgri\GH20082-PA 674 GH20082-PA 233..646 167..581 354 28.2 Plus
Dgri\GH12662-PA 951 GH12662-PA 517..942 164..579 275 23.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
az2-PA 593 CG1605-PA 1..593 10..602 3175 100 Plus
CG1602-PA 577 CG1602-PA 1..565 10..587 1038 38.6 Plus
CG1603-PB 586 CG1603-PB 1..586 10..556 732 30.1 Plus
CG1603-PA 586 CG1603-PA 1..586 10..556 732 30.1 Plus
rgr-PA 856 CG8643-PA 434..847 167..581 360 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20402-PA 600 GI20402-PA 1..593 10..601 1939 61.7 Plus
Dmoj\GI19097-PA 526 GI19097-PA 1..511 10..586 929 36.5 Plus
Dmoj\GI19098-PA 495 GI19098-PA 1..484 10..550 642 31.1 Plus
Dmoj\GI18797-PA 965 GI18797-PA 515..929 166..581 369 28.3 Plus
Dmoj\GI21677-PA 901 GI21677-PA 458..892 165..579 287 24.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20111-PA 576 GL20111-PA 1..567 10..591 888 34.7 Plus
Dper\GL20113-PA 595 GL20113-PA 1..594 10..558 681 31 Plus
Dper\GL10618-PA 894 GL10618-PA 472..886 166..581 347 27.3 Plus
Dper\GL20114-PA 148 GL20114-PA 1..144 10..166 311 46.6 Plus
Dper\GL14945-PA 468 GL14945-PA 204..445 340..578 283 29.1 Plus
Dper\GL10618-PA 894 GL10618-PA 695..845 443..596 188 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14043-PA 590 GA14043-PA 1..583 10..601 2121 67.7 Plus
Dpse\GA14041-PA 576 GA14041-PA 1..567 10..591 908 35.1 Plus
Dpse\GA14042-PB 595 GA14042-PB 1..594 10..558 684 31 Plus
Dpse\GA22224-PA 606 GA22224-PA 172..592 161..584 349 26.5 Plus
Dpse\GA21233-PA 875 GA21233-PA 453..867 166..581 348 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20784-PA 607 GM20784-PA 1..594 10..602 2815 91.1 Plus
Dsec\GM20782-PA 540 GM20782-PA 1..528 10..587 922 36.7 Plus
Dsec\GM20783-PA 583 GM20783-PA 1..581 10..554 691 30.3 Plus
Dsec\GM21048-PA 859 GM21048-PA 436..850 166..581 330 27 Plus
Dsec\GM18162-PA 418 GM18162-PA 190..379 381..576 275 36.9 Plus
Dsec\GM21048-PA 859 GM21048-PA 659..809 443..596 193 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10246-PA 595 GD10246-PA 1..595 10..602 2925 95 Plus
Dsim\GD10244-PA 539 GD10244-PA 1..527 10..587 924 36.9 Plus
Dsim\GD10245-PA 583 GD10245-PA 1..581 10..554 705 29.7 Plus
Dsim\GD10580-PA 820 GD10580-PA 397..811 166..581 333 26.3 Plus
Dsim\GD22772-PA 392 GD22772-PA 168..357 381..576 277 36.5 Plus
Dsim\GD10580-PA 820 GD10580-PA 620..770 443..596 194 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20074-PA 604 GJ20074-PA 1..597 10..601 2004 62.9 Plus
Dvir\GJ20071-PA 572 GJ20071-PA 1..564 10..591 952 37.1 Plus
Dvir\GJ20072-PA 595 GJ20072-PA 1..595 10..563 658 29.8 Plus
Dvir\GJ21825-PA 915 GJ21825-PA 479..893 166..581 381 28.3 Plus
Dvir\GJ17056-PA 657 GJ17056-PA 189..625 154..586 269 24.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19665-PA 600 GK19665-PA 1..594 10..601 1810 58 Plus
Dwil\GK10699-PA 558 GK10699-PA 1..542 10..586 908 36.1 Plus
Dwil\GK10700-PA 601 GK10700-PA 1..585 10..552 679 30.2 Plus
Dwil\GK19707-PA 889 GK19707-PA 454..874 163..581 374 28.4 Plus
Dwil\GK20069-PA 528 GK20069-PA 101..521 161..591 306 26.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23904-PA 588 GE23904-PA 1..588 10..602 2816 89.5 Plus
Dyak\GE23882-PA 547 GE23882-PA 1..535 10..587 962 36.8 Plus
Dyak\GE23893-PA 586 GE23893-PA 1..584 10..554 689 29.6 Plus
Dyak\rgr-PA 857 GE19212-PA 431..848 163..581 323 26.8 Plus
Dyak\GE15250-PA 908 GE15250-PA 470..899 161..579 310 24.3 Plus
Dyak\rgr-PA 857 GE19212-PA 657..807 443..596 191 28.4 Plus

RE20796.hyp Sequence

Translation from 2 to 1810

> RE20796.hyp
CILFVCKQIMVVCGNILARNNFEHFVLACAHQNDCYVEMEFKRWREFIVH
VKEHLEANPSMQQELTTSEVISSAKCEEEVSPAKVFIVEEPPENCLAEDM
FVDVPPSSENDESTSPVEEEEEEDDEVDSSSMTVDCELGTRNSTHFAPLT
KFNPTFYRRSPRITQFIELYKQQTCLWDPADESYRDKEKRANAYEELLEQ
LKATVNLHLTAYKLKKCITSLHAQYASISRQKKTQKLTKVPLYYHGKYSF
LAERGSLEDADSDDVDGDGKIKLVFTEENQLTTQFIDLYSKFPQLYDPAH
KHFCNLNVRKSSLIEITDLLTSEFSLGLVTHYDVYDSIQSMRQWYSRRIK
TLTDVQCVGLSLAEKQYIERCNSFMPTKSFRQKLKCEVCEHSFSTDHALQ
AHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRVHMDKSFVCEICSR
SFAFGNQLAIHKRTHDEKHVAKPFVCEFCGKCFKQKIQMTTHVTAVHTKI
RAFKCDMCPKDFLTKRDLKDHVKAHLNIRDKVCEVCQKAFTNANALVKHR
HIHKEKTLQCSLCTTRFSERVSLGVHMRRTHKILKSSLSSSDALFTKTFP
QP*

RE20796.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
az2-PA 593 CG1605-PA 1..593 10..602 3175 100 Plus
CG1602-PA 577 CG1602-PA 1..565 10..587 1038 38.6 Plus
CG1603-PB 586 CG1603-PB 1..586 10..556 732 30.1 Plus
CG1603-PA 586 CG1603-PA 1..586 10..556 732 30.1 Plus
rgr-PA 856 CG8643-PA 434..847 167..581 360 25.3 Plus